BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_T7_M14 (813 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ257415-1|ABB81846.1| 430|Apis mellifera yellow-like protein p... 25 1.1 AY375535-1|AAQ82648.1| 147|Apis mellifera doublesex protein. 23 2.5 AF514804-1|AAM51823.1| 537|Apis mellifera neuronal nicotinic ac... 23 4.4 >DQ257415-1|ABB81846.1| 430|Apis mellifera yellow-like protein protein. Length = 430 Score = 24.6 bits (51), Expect = 1.1 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = -1 Query: 318 SLISNLSNTCDLTPLPEWSCEQSAWWGACGRVL 220 SL +N + LTP P W+ ++ GACG + Sbjct: 98 SLDTNRGGSPKLTPYPNWAQNKA---GACGSAI 127 >AY375535-1|AAQ82648.1| 147|Apis mellifera doublesex protein. Length = 147 Score = 23.4 bits (48), Expect = 2.5 Identities = 11/40 (27%), Positives = 18/40 (45%) Frame = +3 Query: 585 LPPSPRVLALXPHXDRIRQXPXXLDSETYCIFFXSITKSI 704 +PP+ ++ L PH + P L SE I +K + Sbjct: 95 IPPTRKLPPLHPHTAMVTHLPQTLTSENVEILLEHSSKLV 134 >AF514804-1|AAM51823.1| 537|Apis mellifera neuronal nicotinic acetylcholine receptoralpha-3 protein. Length = 537 Score = 22.6 bits (46), Expect = 4.4 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = +1 Query: 334 WRAAAACTRDTRGALPASPSRLDT 405 W ACT T G + +PS DT Sbjct: 487 WVFTLACTAGTLGIIFQAPSLYDT 510 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 144,905 Number of Sequences: 438 Number of extensions: 2074 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 25853301 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -