BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_T7_M10 (798 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF457549-1|AAL68779.1| 257|Anopheles gambiae antigen 5-related ... 27 0.51 CR954257-15|CAJ14166.1| 271|Anopheles gambiae predicted protein... 25 2.0 AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcript... 25 3.6 AF533893-1|AAM97678.1| 570|Anopheles gambiae ascorbate transpor... 23 8.3 >AF457549-1|AAL68779.1| 257|Anopheles gambiae antigen 5-related 2 protein protein. Length = 257 Score = 27.5 bits (58), Expect = 0.51 Identities = 17/53 (32%), Positives = 26/53 (49%), Gaps = 4/53 (7%) Frame = +2 Query: 632 LGCHKPVIPGGTFLAPLAKTLYTKGSIGRAFAV----PMRTEIWIXQLWPFAP 778 +GC+ P IPGG A L + T S + + R+++ + QL PF P Sbjct: 36 VGCNPPGIPGGPACAGLKPMVITINSTLQTLILSEHNTRRSQLALGQLKPFLP 88 >CR954257-15|CAJ14166.1| 271|Anopheles gambiae predicted protein protein. Length = 271 Score = 25.4 bits (53), Expect = 2.0 Identities = 21/95 (22%), Positives = 38/95 (40%), Gaps = 7/95 (7%) Frame = +1 Query: 40 LNRSQHDAALPSTTPRQERKSSTDYSEPRHRTELYPDLR-------SRDARVKKKTDSID 198 L RS +++ ++T ++ + Y + R + DLR D ++ D +D Sbjct: 62 LRRSSRPSSMRASTMKKLNEWLDAYQQERGKGRSMTDLRLAGYGSSEEDENLRAPRDFLD 121 Query: 199 LRDPNGLRRRVSRFECETRLVKSHCLEPPDSRGST 303 PN L++ E K EPP+ + T Sbjct: 122 AGKPNDLQQEGETLNKEPVETKPQESEPPEMQEVT 156 >AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcriptase protein. Length = 1099 Score = 24.6 bits (51), Expect = 3.6 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = -1 Query: 681 RGARKVPPGITGLWQPSVHSDVAF 610 R A +V P I G WQ H DV+F Sbjct: 892 RWAHRVLPNI-GSWQSRKHGDVSF 914 >AF533893-1|AAM97678.1| 570|Anopheles gambiae ascorbate transporter protein. Length = 570 Score = 23.4 bits (48), Expect = 8.3 Identities = 18/56 (32%), Positives = 25/56 (44%), Gaps = 3/56 (5%) Frame = +2 Query: 629 TLGCHKPVIPGGT--FLAP-LAKTLYTKGSIGRAFAVPMRTEIWIXQLWPFAPREV 787 T GC P++ GGT FL P LA + A+ T+ +LW RE+ Sbjct: 94 TWGCRLPLVQGGTISFLVPTLAILNLPQWKCPPDDAINAMTDTDRTELWQVRMREL 149 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 815,991 Number of Sequences: 2352 Number of extensions: 16006 Number of successful extensions: 27 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 26 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 27 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 83992206 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -