BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_T7_L21 (867 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_06_1573 - 38329476-38329591,38330535-38330871 32 0.68 01_06_0581 - 30386018-30386440 29 4.8 >01_06_1573 - 38329476-38329591,38330535-38330871 Length = 150 Score = 31.9 bits (69), Expect = 0.68 Identities = 21/60 (35%), Positives = 23/60 (38%) Frame = +1 Query: 496 LKPPLVXV*WRGGKXXPREXXKPGAXXGGXXLPGRQAXCARGRVSGKEXWEXCHAXXPPL 675 L PL+ V W GG P + G G A R R G E W CHA P L Sbjct: 26 LLAPLLTVMWFGGLLVPWKQQSGAEALLGE---GDAAWTTRARQHGLEVWMRCHAQKPKL 82 >01_06_0581 - 30386018-30386440 Length = 140 Score = 29.1 bits (62), Expect = 4.8 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = +1 Query: 271 SGVRSQVLERLEMRLRSGGGGARRQ 345 SG+ +V +R+E R GGGG RR+ Sbjct: 31 SGIEVKVRKRVEKEARMGGGGRRRR 55 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,762,144 Number of Sequences: 37544 Number of extensions: 244581 Number of successful extensions: 800 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 769 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 799 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2432722788 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -