BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_T7_L21 (867 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calc... 24 5.2 AF492464-1|AAM11657.1| 803|Anopheles gambiae beta nu integrin s... 24 5.2 AY745220-1|AAU93487.1| 101|Anopheles gambiae cytochrome P450 pr... 23 9.1 AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-conta... 23 9.1 AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subu... 23 9.1 AF020851-1|AAC31864.1| 214|Anopheles gambiae unknown protein. 23 9.1 AF020850-1|AAC31863.1| 214|Anopheles gambiae unknown protein. 23 9.1 AF020849-1|AAC31862.1| 214|Anopheles gambiae unknown protein. 23 9.1 >EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calcium channel alpha2-delta subunit 1 protein. Length = 1256 Score = 24.2 bits (50), Expect = 5.2 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +2 Query: 53 FYNITSQEHGTSIRGRGCSMDPLDC 127 F NITS+ ++ + C+ D LDC Sbjct: 930 FINITSKCTASTTCKKNCASDELDC 954 >AF492464-1|AAM11657.1| 803|Anopheles gambiae beta nu integrin subunit AgBnu protein. Length = 803 Score = 24.2 bits (50), Expect = 5.2 Identities = 6/12 (50%), Positives = 9/12 (75%) Frame = -2 Query: 485 YIMGRCRCRAGW 450 Y+ G+C+C GW Sbjct: 487 YVCGQCQCYVGW 498 >AY745220-1|AAU93487.1| 101|Anopheles gambiae cytochrome P450 protein. Length = 101 Score = 23.4 bits (48), Expect = 9.1 Identities = 12/31 (38%), Positives = 14/31 (45%) Frame = +1 Query: 64 YVPGARHFHPRSWLQYGSLRL*KDRVGAGQK 156 Y P F P WL+ G L+ AGQK Sbjct: 12 YFPEPDRFVPERWLKRGELKEHSGCPHAGQK 42 >AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-containing phosphoprotein protein. Length = 1200 Score = 23.4 bits (48), Expect = 9.1 Identities = 12/28 (42%), Positives = 14/28 (50%) Frame = +1 Query: 265 SGSGVRSQVLERLEMRLRSGGGGARRQR 348 +GSG RS+ R R RSG R R Sbjct: 1091 AGSGSRSRSRSRSRSRSRSGSAKGSRSR 1118 >AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subunit protein. Length = 837 Score = 23.4 bits (48), Expect = 9.1 Identities = 6/11 (54%), Positives = 8/11 (72%) Frame = -2 Query: 482 IMGRCRCRAGW 450 + G+C CR GW Sbjct: 612 VCGQCECREGW 622 >AF020851-1|AAC31864.1| 214|Anopheles gambiae unknown protein. Length = 214 Score = 23.4 bits (48), Expect = 9.1 Identities = 11/37 (29%), Positives = 16/37 (43%) Frame = -2 Query: 323 PLRSLISNLSNTCDLTPLPEWSCEQSAWWGACGRVLD 213 PL L SN ++ P P W + + CG + D Sbjct: 128 PLGILPSNQRSSSSSKPTPCWESNKDVFPKPCGNLTD 164 >AF020850-1|AAC31863.1| 214|Anopheles gambiae unknown protein. Length = 214 Score = 23.4 bits (48), Expect = 9.1 Identities = 11/37 (29%), Positives = 16/37 (43%) Frame = -2 Query: 323 PLRSLISNLSNTCDLTPLPEWSCEQSAWWGACGRVLD 213 PL L SN ++ P P W + + CG + D Sbjct: 128 PLGILPSNQRSSSSSKPTPCWESNKDVFPKPCGNLTD 164 >AF020849-1|AAC31862.1| 214|Anopheles gambiae unknown protein. Length = 214 Score = 23.4 bits (48), Expect = 9.1 Identities = 11/37 (29%), Positives = 16/37 (43%) Frame = -2 Query: 323 PLRSLISNLSNTCDLTPLPEWSCEQSAWWGACGRVLD 213 PL L SN ++ P P W + + CG + D Sbjct: 128 PLGILPSNQRSSSSSKPTPCWESNKDVFPKPCGNLTD 164 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 492,009 Number of Sequences: 2352 Number of extensions: 6778 Number of successful extensions: 27 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 26 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 27 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 92613024 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -