BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_T7_L19 (813 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g05570.1 68418.m00605 transducin family protein / WD-40 repea... 38 0.008 At4g11270.1 68417.m01823 transducin family protein / WD-40 repea... 31 0.91 At3g18950.1 68416.m02405 transducin family protein / WD-40 repea... 30 2.1 At4g01860.2 68417.m00244 transducin family protein / WD-40 repea... 29 2.8 At4g01860.1 68417.m00243 transducin family protein / WD-40 repea... 29 2.8 At5g05970.1 68418.m00661 transducin family protein / WD-40 repea... 29 3.7 At3g06880.1 68416.m00817 transducin family protein / WD-40 repea... 29 3.7 At2g47990.1 68415.m06006 transducin family protein / WD-40 repea... 29 3.7 At2g46560.1 68415.m05808 transducin family protein / WD-40 repea... 29 3.7 At2g26490.1 68415.m03178 transducin family protein / WD-40 repea... 29 3.7 At2g20330.1 68415.m02374 transducin family protein / WD-40 repea... 29 4.9 At1g03110.1 68414.m00288 transducin family protein / WD-40 repea... 29 4.9 At5g25150.1 68418.m02981 transducin family protein / WD-40 repea... 28 6.4 At1g47610.1 68414.m05288 transducin family protein / WD-40 repea... 28 6.4 At5g50230.1 68418.m06221 transducin family protein / WD-40 repea... 28 8.5 At4g35560.1 68417.m05053 expressed protein 28 8.5 At3g15980.3 68416.m02022 coatomer protein complex, subunit beta ... 28 8.5 At3g15980.2 68416.m02021 coatomer protein complex, subunit beta ... 28 8.5 At3g15980.1 68416.m02020 coatomer protein complex, subunit beta ... 28 8.5 At1g79990.1 68414.m09356 coatomer protein complex, subunit beta ... 28 8.5 At1g52360.1 68414.m05909 coatomer protein complex, subunit beta ... 28 8.5 At1g49450.1 68414.m05543 transducin family protein / WD-40 repea... 28 8.5 At1g27840.1 68414.m03412 transducin family protein / WD-40 repea... 28 8.5 At1g19750.1 68414.m02469 transducin family protein / WD-40 repea... 28 8.5 >At5g05570.1 68418.m00605 transducin family protein / WD-40 repeat family protein similar to unknown protein (pir||T04661); contains Pfam PF00400: WD domain, G-beta repeat (4 copies, 2 weak)|8683726|gb|AV524198.1|AV524198 Length = 1124 Score = 37.9 bits (84), Expect = 0.008 Identities = 16/54 (29%), Positives = 30/54 (55%), Gaps = 1/54 (1%) Frame = -3 Query: 229 TXRRINXSESPWPISGGVVETAE-LTDRQVLLTGHEDGSVRFWDVTGVAMTPLY 71 T R + + WP++GGV + ++ + G++DGS+R WD T ++ +Y Sbjct: 464 TPRTPSGESAQWPLTGGVPSHVDDYKLERLYMAGYQDGSMRIWDATYPCLSLIY 517 >At4g11270.1 68417.m01823 transducin family protein / WD-40 repeat family protein contains 5 WD-40 repeats (PF00400); related to TGF-beta resistance-associated protein TRAG (GI:15624071) {Mus musculus}; similar to beta-transducin repeats containing protein - Homo sapiens,PID:e1284220; 3' EST no_NP:TC8031 Length = 1446 Score = 31.1 bits (67), Expect = 0.91 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = -3 Query: 193 PISGGVVETAELTDRQVLLTGHEDGSVRFWDVT 95 P S V TA LT+ L TG DGS+ +W ++ Sbjct: 14 PPSHRVTATASLTNPPTLYTGGSDGSIIWWSIS 46 >At3g18950.1 68416.m02405 transducin family protein / WD-40 repeat family protein contains 7 WD-40 repeats (PF00400); similar to En/Spm-like transposon protein GI:2739374 from [Arabidopsis thaliana]; no characterized homologs Length = 473 Score = 29.9 bits (64), Expect = 2.1 Identities = 10/28 (35%), Positives = 17/28 (60%) Frame = -3 Query: 187 SGGVVETAELTDRQVLLTGHEDGSVRFW 104 + G+V+ +T + TGH+DG +R W Sbjct: 175 TSGLVKAIVITGDNRIFTGHQDGKIRVW 202 >At4g01860.2 68417.m00244 transducin family protein / WD-40 repeat family protein contains ten G-protein beta-subunit (beta-transducin) WD-40 repeats Length = 1308 Score = 29.5 bits (63), Expect = 2.8 Identities = 11/21 (52%), Positives = 16/21 (76%) Frame = -3 Query: 157 TDRQVLLTGHEDGSVRFWDVT 95 +D +L++G DGS+ FWDVT Sbjct: 1032 SDVYLLISGATDGSIGFWDVT 1052 >At4g01860.1 68417.m00243 transducin family protein / WD-40 repeat family protein contains ten G-protein beta-subunit (beta-transducin) WD-40 repeats Length = 1308 Score = 29.5 bits (63), Expect = 2.8 Identities = 11/21 (52%), Positives = 16/21 (76%) Frame = -3 Query: 157 TDRQVLLTGHEDGSVRFWDVT 95 +D +L++G DGS+ FWDVT Sbjct: 1032 SDVYLLISGATDGSIGFWDVT 1052 >At5g05970.1 68418.m00661 transducin family protein / WD-40 repeat family protein contains similarity to regulatory protein Nedd1; contains Pfam PF00400: WD domain, G-beta repeat (6 copies, 2 weak)|19804256|gb|AV785466.1|AV785466 Length = 781 Score = 29.1 bits (62), Expect = 3.7 Identities = 10/22 (45%), Positives = 15/22 (68%) Frame = -3 Query: 157 TDRQVLLTGHEDGSVRFWDVTG 92 + R +L+T +DG+V WD TG Sbjct: 189 SSRHLLVTAGDDGTVHLWDTTG 210 >At3g06880.1 68416.m00817 transducin family protein / WD-40 repeat family protein similar to PAK/PLC-interacting protein 1 (GI:4211689) {Homo sapiens} Length = 1115 Score = 29.1 bits (62), Expect = 3.7 Identities = 14/39 (35%), Positives = 21/39 (53%) Frame = -3 Query: 187 SGGVVETAELTDRQVLLTGHEDGSVRFWDVTGVAMTPLY 71 SG TA + + +L +G DGS+R W+V T L+ Sbjct: 851 SGSGAVTALIYHKGLLFSGFSDGSIRVWNVNKKIATLLW 889 >At2g47990.1 68415.m06006 transducin family protein / WD-40 repeat family protein similar to Vegetatible incompatibility protein HET-E-1 (SP:Q00808) {Podospora anserina}; contains 5 WD-40 repeats (PF00400); similar to beta transducin-like protein HET-E2C*4 (GP:17225206)[Podospora anserina] Length = 530 Score = 29.1 bits (62), Expect = 3.7 Identities = 10/24 (41%), Positives = 17/24 (70%) Frame = -3 Query: 154 DRQVLLTGHEDGSVRFWDVTGVAM 83 D+ L++G +DG V++WDV G + Sbjct: 147 DKLHLVSGGDDGVVKYWDVAGATV 170 >At2g46560.1 68415.m05808 transducin family protein / WD-40 repeat family protein similar to CPY (GI:3096961) {Chironomus thummi}; contains Pfam PF00400: WD domain, G-beta repeat (8 copies, 3 weak)|9780477|gb|BE522499.1|BE522499 Length = 2471 Score = 29.1 bits (62), Expect = 3.7 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -3 Query: 184 GGVVETAELTDRQVLLTGHEDGSVRFWD 101 G V + A + + LTG +DG V+ WD Sbjct: 2376 GSVTKIATIPRTSLFLTGSKDGEVKLWD 2403 >At2g26490.1 68415.m03178 transducin family protein / WD-40 repeat family protein contains 7 WD-40 repeats (PF00400); related to En/Spm transposon family of maize Length = 465 Score = 29.1 bits (62), Expect = 3.7 Identities = 11/36 (30%), Positives = 22/36 (61%) Frame = -3 Query: 202 SPWPISGGVVETAELTDRQVLLTGHEDGSVRFWDVT 95 S + + G+V+ ++ ++ TGH+DG +R W V+ Sbjct: 128 SAFKCNSGLVKAIVISGEKIF-TGHQDGKIRVWKVS 162 >At2g20330.1 68415.m02374 transducin family protein / WD-40 repeat family protein similar to Transcriptional repressor rco-1 (SP:P78706) [Neurospora crassa]; similar to TUP1(GB:AF079369); contains 6 WD-40 repeats (PF00400) Length = 648 Score = 28.7 bits (61), Expect = 4.9 Identities = 10/18 (55%), Positives = 14/18 (77%) Frame = -3 Query: 151 RQVLLTGHEDGSVRFWDV 98 ++ +LT EDGS+R WDV Sbjct: 291 KETVLTSSEDGSLRIWDV 308 >At1g03110.1 68414.m00288 transducin family protein / WD-40 repeat family protein contains 4 WD-40 repeats (PF00400); similar to WD-repeat domain 4 protein (GI:9955698) [Mus musculus] Length = 427 Score = 28.7 bits (61), Expect = 4.9 Identities = 14/39 (35%), Positives = 23/39 (58%) Frame = -3 Query: 175 VETAELTDRQVLLTGHEDGSVRFWDVTGVAMTPLYKYTT 59 V T ELT + L++G D +VR WD+T ++ + +T Sbjct: 212 VSTPELT-QGYLMSGSGDSTVRLWDITSGSLLDTCEVST 249 >At5g25150.1 68418.m02981 transducin family protein / WD-40 repeat family protein similar to TBP-associated factor (GI:1732075) [Homo sapiens] and to 100 kDa subunit of Pol II transcription factor (GI:1491718) {Homo sapiens]; contains Pfam PF00400: WD domain, G-beta repeat (6 copies)|8689032|gb|AV528749.1|AV528749 Length = 666 Score = 28.3 bits (60), Expect = 6.4 Identities = 13/36 (36%), Positives = 21/36 (58%), Gaps = 1/36 (2%) Frame = -3 Query: 178 VVETAELTDRQVLLTGHEDGSVRFWDV-TGVAMTPL 74 V+ A D + + +G EDG++ WD+ T +TPL Sbjct: 544 VLSLAMSPDGRYMASGDEDGTIMMWDLSTARCITPL 579 >At1g47610.1 68414.m05288 transducin family protein / WD-40 repeat family protein contains 7 WD-40 repeats (PF00400); similar to En/Spm-like transposon protein (GI:2739374) [Arabidopsis thaliana] Length = 351 Score = 28.3 bits (60), Expect = 6.4 Identities = 9/28 (32%), Positives = 17/28 (60%) Frame = -3 Query: 187 SGGVVETAELTDRQVLLTGHEDGSVRFW 104 + G+V+ ++ + TGH+DG +R W Sbjct: 61 NSGLVKAIVISREAKVFTGHQDGKIRVW 88 >At5g50230.1 68418.m06221 transducin family protein / WD-40 repeat family protein contains 7 WD-40 repeats (PF00400); similar to TIPD PROTEIN (SP:O15736)[Dictyostelium discoideum] Length = 515 Score = 27.9 bits (59), Expect = 8.5 Identities = 11/34 (32%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Frame = -3 Query: 154 DRQVLLTGHEDGSVRFWDV-TGVAMTPLYKYTTA 56 D + +GH DG++R WD+ TG ++ + +++A Sbjct: 368 DGLTVFSGHMDGNLRLWDIQTGKLLSEVAGHSSA 401 >At4g35560.1 68417.m05053 expressed protein Length = 917 Score = 27.9 bits (59), Expect = 8.5 Identities = 9/19 (47%), Positives = 14/19 (73%) Frame = -3 Query: 151 RQVLLTGHEDGSVRFWDVT 95 + V +TGH DG++ WD+T Sbjct: 309 KNVYITGHCDGTISVWDMT 327 >At3g15980.3 68416.m02022 coatomer protein complex, subunit beta 2 (beta prime), putative contains 7 WD-40 repeats (PF00400) (1 weak); identical to coatomer protein complex, beta prime (beta'-COP) protein {Arabidopsis thaliana} (GI:9294445); similar to Coatomer beta' subunit (Beta'-coat protein) (Beta'-COP) (p102) (SP:P35606) [Homo sapiens] Length = 918 Score = 27.9 bits (59), Expect = 8.5 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = -3 Query: 145 VLLTGHEDGSVRFWDVT 95 +++TG EDG+VR W T Sbjct: 243 IIITGSEDGTVRIWHAT 259 >At3g15980.2 68416.m02021 coatomer protein complex, subunit beta 2 (beta prime), putative contains 7 WD-40 repeats (PF00400) (1 weak); identical to coatomer protein complex, beta prime (beta'-COP) protein {Arabidopsis thaliana} (GI:9294445); similar to Coatomer beta' subunit (Beta'-coat protein) (Beta'-COP) (p102) (SP:P35606) [Homo sapiens] Length = 918 Score = 27.9 bits (59), Expect = 8.5 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = -3 Query: 145 VLLTGHEDGSVRFWDVT 95 +++TG EDG+VR W T Sbjct: 243 IIITGSEDGTVRIWHAT 259 >At3g15980.1 68416.m02020 coatomer protein complex, subunit beta 2 (beta prime), putative contains 7 WD-40 repeats (PF00400) (1 weak); identical to coatomer protein complex, beta prime (beta'-COP) protein {Arabidopsis thaliana} (GI:9294445); similar to Coatomer beta' subunit (Beta'-coat protein) (Beta'-COP) (p102) (SP:P35606) [Homo sapiens] Length = 909 Score = 27.9 bits (59), Expect = 8.5 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = -3 Query: 145 VLLTGHEDGSVRFWDVT 95 +++TG EDG+VR W T Sbjct: 243 IIITGSEDGTVRIWHAT 259 >At1g79990.1 68414.m09356 coatomer protein complex, subunit beta 2 (beta prime), putative contains 7 WD-40 repeats (PF00400) (1 weak); similar to Coatomer beta' subunit (Beta'-coat protein) (Beta'-COP) (p102) (SP:P35606) [Homo sapiens]; similar to Coatomer beta' subunit (Beta'-coat protein) (Beta'-COP) (p102) (SP:O55029) [Mus musculus] Length = 920 Score = 27.9 bits (59), Expect = 8.5 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = -3 Query: 145 VLLTGHEDGSVRFWDVT 95 +++TG EDG+VR W T Sbjct: 243 IIITGSEDGTVRIWHAT 259 >At1g52360.1 68414.m05909 coatomer protein complex, subunit beta 2 (beta prime), putative contains 7 WD-40 repeats (PF00400) (1 weak); similar to (SP:O55029) Coatomer beta' subunit (Beta'-coat protein) (Beta'-COP) (p102) (SP:O55029) [Mus musculus]; similar to GI:298096 from [Homo sapiens] Length = 926 Score = 27.9 bits (59), Expect = 8.5 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = -3 Query: 145 VLLTGHEDGSVRFWDVT 95 +++TG EDG+VR W T Sbjct: 243 IIITGSEDGTVRIWHAT 259 >At1g49450.1 68414.m05543 transducin family protein / WD-40 repeat family protein contains 7 WD-40 repeats (PF00400); similar to En/Spm-like transposon protein GI:2739374 from [Arabidopsis thaliana]; no characterized homologs Length = 471 Score = 27.9 bits (59), Expect = 8.5 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = -3 Query: 187 SGGVVETAELTDRQVLLTGHEDGSVRFW 104 + G V+ +T + TGH+DG +R W Sbjct: 171 TSGFVKAIVVTRDNRVFTGHQDGKIRVW 198 >At1g27840.1 68414.m03412 transducin family protein / WD-40 repeat family protein contains similarity to cockayne syndrome complementation group A protein GB:U28413 GI:975301 from [Homo sapiens]; confirmed by cDNA gi:1598289 Length = 450 Score = 27.9 bits (59), Expect = 8.5 Identities = 10/16 (62%), Positives = 13/16 (81%) Frame = -3 Query: 145 VLLTGHEDGSVRFWDV 98 VL TG DG++RFWD+ Sbjct: 205 VLYTGGCDGAIRFWDI 220 >At1g19750.1 68414.m02469 transducin family protein / WD-40 repeat family protein similar to Cockayne syndrome complementaion group A proteins (GI:18077663)[Mus musculus] and (SP:Q13216)[Homo sapiens]; confirmed by full-length cDNA GI:15982896 Length = 450 Score = 27.9 bits (59), Expect = 8.5 Identities = 10/16 (62%), Positives = 13/16 (81%) Frame = -3 Query: 145 VLLTGHEDGSVRFWDV 98 VL TG DG++RFWD+ Sbjct: 205 VLYTGGCDGAIRFWDI 220 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,069,490 Number of Sequences: 28952 Number of extensions: 203016 Number of successful extensions: 766 Number of sequences better than 10.0: 24 Number of HSP's better than 10.0 without gapping: 691 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 765 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1853336000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -