BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_T7_L18 (821 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_52112| Best HMM Match : PH (HMM E-Value=2.4e-14) 29 3.4 SB_39888| Best HMM Match : PH (HMM E-Value=3.5e-22) 29 4.6 >SB_52112| Best HMM Match : PH (HMM E-Value=2.4e-14) Length = 356 Score = 29.5 bits (63), Expect = 3.4 Identities = 12/41 (29%), Positives = 23/41 (56%) Frame = -1 Query: 764 RDEMDFREWTKGYTVXSSQERGXLTAXSSPVQSQXPWRGGS 642 +D + ++W K TV +S + +T S+P+ + WR G+ Sbjct: 73 KDNQELKDWVKALTVAASGGKYTMTQESAPLTPEG-WRTGT 112 >SB_39888| Best HMM Match : PH (HMM E-Value=3.5e-22) Length = 1067 Score = 29.1 bits (62), Expect = 4.6 Identities = 12/41 (29%), Positives = 23/41 (56%) Frame = -1 Query: 764 RDEMDFREWTKGYTVXSSQERGXLTAXSSPVQSQXPWRGGS 642 +D + ++W K TV +S + +T S+P+ + WR G+ Sbjct: 557 KDNQELKDWVKALTVAASGGKYTMTHESAPLTPEG-WRTGT 596 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,020,744 Number of Sequences: 59808 Number of extensions: 184808 Number of successful extensions: 525 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 384 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 525 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2299585728 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -