BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_T7_L16 (828 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g19200.1 68417.m02833 proline-rich family protein contains pr... 29 5.0 >At4g19200.1 68417.m02833 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 179 Score = 28.7 bits (61), Expect = 5.0 Identities = 14/38 (36%), Positives = 17/38 (44%) Frame = +1 Query: 553 KQEHHGEHGAGRPSRVPGGASPXKTSGTLPRELPPRQG 666 K +HH E G GG P G P+ PP+QG Sbjct: 5 KDKHHDEQEKGFHGFPGGGHYPPAQGGYPPQGYPPQQG 42 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,963,479 Number of Sequences: 28952 Number of extensions: 156712 Number of successful extensions: 369 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 358 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 369 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1902108000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -