BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_T7_L14 (784 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC008492-1|AAH08492.1| 403|Homo sapiens ribosomal protein L3 pr... 52 2e-06 X73460-1|CAA51839.1| 403|Homo sapiens ribosomal protein L3 prot... 52 2e-06 M90054-1|AAA60291.1| 398|Homo sapiens ribosomal protein L3 prot... 52 2e-06 CR456566-1|CAG30452.1| 403|Homo sapiens RPL3 protein. 52 2e-06 BC107711-1|AAI07712.1| 403|Homo sapiens ribosomal protein L3 pr... 52 2e-06 BC088373-1|AAH88373.1| 403|Homo sapiens ribosomal protein L3 pr... 52 2e-06 BC063662-1|AAH63662.1| 403|Homo sapiens ribosomal protein L3 pr... 52 2e-06 BC036582-1|AAH36582.1| 251|Homo sapiens RPL3 protein protein. 52 2e-06 BC022790-1|AAH22790.1| 374|Homo sapiens Unknown (protein for IM... 52 2e-06 BC015767-1|AAH15767.1| 403|Homo sapiens ribosomal protein L3 pr... 52 2e-06 BC015032-1|AAH15032.1| 403|Homo sapiens ribosomal protein L3, i... 52 2e-06 BC014017-1|AAH14017.1| 403|Homo sapiens ribosomal protein L3 pr... 52 2e-06 BC013674-1|AAH13674.1| 403|Homo sapiens ribosomal protein L3 pr... 52 2e-06 BC012786-1|AAH12786.1| 403|Homo sapiens ribosomal protein L3 pr... 52 2e-06 BC012146-1|AAH12146.1| 403|Homo sapiens ribosomal protein L3 pr... 52 2e-06 BC008003-1|AAH08003.1| 403|Homo sapiens ribosomal protein L3 pr... 52 2e-06 BC006483-1|AAH06483.1| 403|Homo sapiens ribosomal protein L3, i... 52 2e-06 BC004323-1|AAH04323.2| 292|Homo sapiens RPL3 protein protein. 52 2e-06 BC002408-1|AAH02408.1| 403|Homo sapiens ribosomal protein L3 pr... 52 2e-06 AL022326-1|CAA18450.1| 403|Homo sapiens ribosomal protein L3 pr... 52 2e-06 AJ238852-1|CAB76201.1| 343|Homo sapiens ribosomal protein L3 pr... 52 2e-06 AB062291-1|BAB93474.1| 403|Homo sapiens ribosomal protein L3 pr... 52 2e-06 AB007166-1|BAA25828.1| 71|Homo sapiens ribosomal protein L3 pr... 52 2e-06 U65581-1|AAC50777.1| 407|Homo sapiens ribosomal protein L3-like... 46 1e-04 BC050413-1|AAH50413.1| 407|Homo sapiens ribosomal protein L3-li... 46 1e-04 AE006640-5|AAK61301.1| 406|Homo sapiens 60S ribosomal protein L... 46 1e-04 >BC008492-1|AAH08492.1| 403|Homo sapiens ribosomal protein L3 protein. Length = 403 Score = 52.4 bits (120), Expect = 2e-06 Identities = 25/39 (64%), Positives = 29/39 (74%) Frame = -1 Query: 226 KRAALEKINLKFIDTSSKFGHGRFQTPAXQGCIHGYTQE 110 KR ALEKI+LKFIDT+SKFGHGRFQT + G +E Sbjct: 356 KRRALEKIDLKFIDTTSKFGHGRFQTMEEKKAFMGPLKE 394 >X73460-1|CAA51839.1| 403|Homo sapiens ribosomal protein L3 protein. Length = 403 Score = 52.0 bits (119), Expect = 2e-06 Identities = 23/26 (88%), Positives = 25/26 (96%) Frame = -1 Query: 226 KRAALEKINLKFIDTSSKFGHGRFQT 149 KR ALEKI+LKFIDT+SKFGHGRFQT Sbjct: 356 KRRALEKIDLKFIDTTSKFGHGRFQT 381 >M90054-1|AAA60291.1| 398|Homo sapiens ribosomal protein L3 protein. Length = 398 Score = 52.0 bits (119), Expect = 2e-06 Identities = 23/26 (88%), Positives = 25/26 (96%) Frame = -1 Query: 226 KRAALEKINLKFIDTSSKFGHGRFQT 149 KR ALEKI+LKFIDT+SKFGHGRFQT Sbjct: 351 KRRALEKIDLKFIDTTSKFGHGRFQT 376 >CR456566-1|CAG30452.1| 403|Homo sapiens RPL3 protein. Length = 403 Score = 52.0 bits (119), Expect = 2e-06 Identities = 23/26 (88%), Positives = 25/26 (96%) Frame = -1 Query: 226 KRAALEKINLKFIDTSSKFGHGRFQT 149 KR ALEKI+LKFIDT+SKFGHGRFQT Sbjct: 356 KRRALEKIDLKFIDTTSKFGHGRFQT 381 >BC107711-1|AAI07712.1| 403|Homo sapiens ribosomal protein L3 protein. Length = 403 Score = 52.0 bits (119), Expect = 2e-06 Identities = 23/26 (88%), Positives = 25/26 (96%) Frame = -1 Query: 226 KRAALEKINLKFIDTSSKFGHGRFQT 149 KR ALEKI+LKFIDT+SKFGHGRFQT Sbjct: 356 KRRALEKIDLKFIDTTSKFGHGRFQT 381 >BC088373-1|AAH88373.1| 403|Homo sapiens ribosomal protein L3 protein. Length = 403 Score = 52.0 bits (119), Expect = 2e-06 Identities = 23/26 (88%), Positives = 25/26 (96%) Frame = -1 Query: 226 KRAALEKINLKFIDTSSKFGHGRFQT 149 KR ALEKI+LKFIDT+SKFGHGRFQT Sbjct: 356 KRRALEKIDLKFIDTTSKFGHGRFQT 381 >BC063662-1|AAH63662.1| 403|Homo sapiens ribosomal protein L3 protein. Length = 403 Score = 52.0 bits (119), Expect = 2e-06 Identities = 23/26 (88%), Positives = 25/26 (96%) Frame = -1 Query: 226 KRAALEKINLKFIDTSSKFGHGRFQT 149 KR ALEKI+LKFIDT+SKFGHGRFQT Sbjct: 356 KRRALEKIDLKFIDTTSKFGHGRFQT 381 >BC036582-1|AAH36582.1| 251|Homo sapiens RPL3 protein protein. Length = 251 Score = 52.0 bits (119), Expect = 2e-06 Identities = 23/26 (88%), Positives = 25/26 (96%) Frame = -1 Query: 226 KRAALEKINLKFIDTSSKFGHGRFQT 149 KR ALEKI+LKFIDT+SKFGHGRFQT Sbjct: 204 KRRALEKIDLKFIDTTSKFGHGRFQT 229 >BC022790-1|AAH22790.1| 374|Homo sapiens Unknown (protein for IMAGE:3538792) protein. Length = 374 Score = 52.0 bits (119), Expect = 2e-06 Identities = 23/26 (88%), Positives = 25/26 (96%) Frame = -1 Query: 226 KRAALEKINLKFIDTSSKFGHGRFQT 149 KR ALEKI+LKFIDT+SKFGHGRFQT Sbjct: 327 KRRALEKIDLKFIDTTSKFGHGRFQT 352 >BC015767-1|AAH15767.1| 403|Homo sapiens ribosomal protein L3 protein. Length = 403 Score = 52.0 bits (119), Expect = 2e-06 Identities = 23/26 (88%), Positives = 25/26 (96%) Frame = -1 Query: 226 KRAALEKINLKFIDTSSKFGHGRFQT 149 KR ALEKI+LKFIDT+SKFGHGRFQT Sbjct: 356 KRRALEKIDLKFIDTTSKFGHGRFQT 381 >BC015032-1|AAH15032.1| 403|Homo sapiens ribosomal protein L3, isoform a protein. Length = 403 Score = 52.0 bits (119), Expect = 2e-06 Identities = 23/26 (88%), Positives = 25/26 (96%) Frame = -1 Query: 226 KRAALEKINLKFIDTSSKFGHGRFQT 149 KR ALEKI+LKFIDT+SKFGHGRFQT Sbjct: 356 KRRALEKIDLKFIDTTSKFGHGRFQT 381 >BC014017-1|AAH14017.1| 403|Homo sapiens ribosomal protein L3 protein. Length = 403 Score = 52.0 bits (119), Expect = 2e-06 Identities = 23/26 (88%), Positives = 25/26 (96%) Frame = -1 Query: 226 KRAALEKINLKFIDTSSKFGHGRFQT 149 KR ALEKI+LKFIDT+SKFGHGRFQT Sbjct: 356 KRRALEKIDLKFIDTTSKFGHGRFQT 381 >BC013674-1|AAH13674.1| 403|Homo sapiens ribosomal protein L3 protein. Length = 403 Score = 52.0 bits (119), Expect = 2e-06 Identities = 23/26 (88%), Positives = 25/26 (96%) Frame = -1 Query: 226 KRAALEKINLKFIDTSSKFGHGRFQT 149 KR ALEKI+LKFIDT+SKFGHGRFQT Sbjct: 356 KRRALEKIDLKFIDTTSKFGHGRFQT 381 >BC012786-1|AAH12786.1| 403|Homo sapiens ribosomal protein L3 protein. Length = 403 Score = 52.0 bits (119), Expect = 2e-06 Identities = 23/26 (88%), Positives = 25/26 (96%) Frame = -1 Query: 226 KRAALEKINLKFIDTSSKFGHGRFQT 149 KR ALEKI+LKFIDT+SKFGHGRFQT Sbjct: 356 KRRALEKIDLKFIDTTSKFGHGRFQT 381 >BC012146-1|AAH12146.1| 403|Homo sapiens ribosomal protein L3 protein. Length = 403 Score = 52.0 bits (119), Expect = 2e-06 Identities = 23/26 (88%), Positives = 25/26 (96%) Frame = -1 Query: 226 KRAALEKINLKFIDTSSKFGHGRFQT 149 KR ALEKI+LKFIDT+SKFGHGRFQT Sbjct: 356 KRRALEKIDLKFIDTTSKFGHGRFQT 381 >BC008003-1|AAH08003.1| 403|Homo sapiens ribosomal protein L3 protein. Length = 403 Score = 52.0 bits (119), Expect = 2e-06 Identities = 23/26 (88%), Positives = 25/26 (96%) Frame = -1 Query: 226 KRAALEKINLKFIDTSSKFGHGRFQT 149 KR ALEKI+LKFIDT+SKFGHGRFQT Sbjct: 356 KRRALEKIDLKFIDTTSKFGHGRFQT 381 >BC006483-1|AAH06483.1| 403|Homo sapiens ribosomal protein L3, isoform a protein. Length = 403 Score = 52.0 bits (119), Expect = 2e-06 Identities = 23/26 (88%), Positives = 25/26 (96%) Frame = -1 Query: 226 KRAALEKINLKFIDTSSKFGHGRFQT 149 KR ALEKI+LKFIDT+SKFGHGRFQT Sbjct: 356 KRRALEKIDLKFIDTTSKFGHGRFQT 381 >BC004323-1|AAH04323.2| 292|Homo sapiens RPL3 protein protein. Length = 292 Score = 52.0 bits (119), Expect = 2e-06 Identities = 23/26 (88%), Positives = 25/26 (96%) Frame = -1 Query: 226 KRAALEKINLKFIDTSSKFGHGRFQT 149 KR ALEKI+LKFIDT+SKFGHGRFQT Sbjct: 245 KRRALEKIDLKFIDTTSKFGHGRFQT 270 >BC002408-1|AAH02408.1| 403|Homo sapiens ribosomal protein L3 protein. Length = 403 Score = 52.0 bits (119), Expect = 2e-06 Identities = 23/26 (88%), Positives = 25/26 (96%) Frame = -1 Query: 226 KRAALEKINLKFIDTSSKFGHGRFQT 149 KR ALEKI+LKFIDT+SKFGHGRFQT Sbjct: 356 KRRALEKIDLKFIDTTSKFGHGRFQT 381 >AL022326-1|CAA18450.1| 403|Homo sapiens ribosomal protein L3 protein. Length = 403 Score = 52.0 bits (119), Expect = 2e-06 Identities = 23/26 (88%), Positives = 25/26 (96%) Frame = -1 Query: 226 KRAALEKINLKFIDTSSKFGHGRFQT 149 KR ALEKI+LKFIDT+SKFGHGRFQT Sbjct: 356 KRRALEKIDLKFIDTTSKFGHGRFQT 381 >AJ238852-1|CAB76201.1| 343|Homo sapiens ribosomal protein L3 protein. Length = 343 Score = 52.0 bits (119), Expect = 2e-06 Identities = 23/26 (88%), Positives = 25/26 (96%) Frame = -1 Query: 226 KRAALEKINLKFIDTSSKFGHGRFQT 149 KR ALEKI+LKFIDT+SKFGHGRFQT Sbjct: 301 KRRALEKIDLKFIDTTSKFGHGRFQT 326 >AB062291-1|BAB93474.1| 403|Homo sapiens ribosomal protein L3 protein. Length = 403 Score = 52.0 bits (119), Expect = 2e-06 Identities = 23/26 (88%), Positives = 25/26 (96%) Frame = -1 Query: 226 KRAALEKINLKFIDTSSKFGHGRFQT 149 KR ALEKI+LKFIDT+SKFGHGRFQT Sbjct: 356 KRRALEKIDLKFIDTTSKFGHGRFQT 381 >AB007166-1|BAA25828.1| 71|Homo sapiens ribosomal protein L3 protein. Length = 71 Score = 52.0 bits (119), Expect = 2e-06 Identities = 23/26 (88%), Positives = 25/26 (96%) Frame = -1 Query: 226 KRAALEKINLKFIDTSSKFGHGRFQT 149 KR ALEKI+LKFIDT+SKFGHGRFQT Sbjct: 29 KRRALEKIDLKFIDTTSKFGHGRFQT 54 >U65581-1|AAC50777.1| 407|Homo sapiens ribosomal protein L3-like protein. Length = 407 Score = 46.4 bits (105), Expect = 1e-04 Identities = 20/25 (80%), Positives = 22/25 (88%) Frame = -1 Query: 223 RAALEKINLKFIDTSSKFGHGRFQT 149 R A+E I LKFIDT+SKFGHGRFQT Sbjct: 357 RQAVENIELKFIDTTSKFGHGRFQT 381 >BC050413-1|AAH50413.1| 407|Homo sapiens ribosomal protein L3-like protein. Length = 407 Score = 46.4 bits (105), Expect = 1e-04 Identities = 20/25 (80%), Positives = 22/25 (88%) Frame = -1 Query: 223 RAALEKINLKFIDTSSKFGHGRFQT 149 R A+E I LKFIDT+SKFGHGRFQT Sbjct: 357 RQAVENIELKFIDTTSKFGHGRFQT 381 >AE006640-5|AAK61301.1| 406|Homo sapiens 60S ribosomal protein L3 like protein. Length = 406 Score = 46.4 bits (105), Expect = 1e-04 Identities = 20/25 (80%), Positives = 22/25 (88%) Frame = -1 Query: 223 RAALEKINLKFIDTSSKFGHGRFQT 149 R A+E I LKFIDT+SKFGHGRFQT Sbjct: 356 RQAVENIELKFIDTTSKFGHGRFQT 380 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 71,068,801 Number of Sequences: 237096 Number of extensions: 1019079 Number of successful extensions: 1282 Number of sequences better than 10.0: 26 Number of HSP's better than 10.0 without gapping: 1096 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1274 length of database: 76,859,062 effective HSP length: 89 effective length of database: 55,757,518 effective search space used: 9534535578 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -