BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_T7_L08 (872 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value S73225-1|AAB30811.1| 327|Tribolium castaneum protein ( Triboliu... 21 9.6 AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 ... 21 9.6 >S73225-1|AAB30811.1| 327|Tribolium castaneum protein ( Tribolium castaneum homeodomainprotein mRNA, complete cds. ). Length = 327 Score = 21.4 bits (43), Expect = 9.6 Identities = 12/34 (35%), Positives = 14/34 (41%) Frame = +2 Query: 521 RKSDRLAVYRVPTRQAGSGPAGYSGTPAALSGRP 622 R SDR + R P + P G P A RP Sbjct: 198 RYSDRPSSGRSPRTRRVKKPGAKQGAPTAEEKRP 231 >AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 protein protein. Length = 371 Score = 21.4 bits (43), Expect = 9.6 Identities = 9/28 (32%), Positives = 14/28 (50%) Frame = -1 Query: 506 RARVPVACRAASTPSSRPLTFTGGKPPS 423 +A A R+ +TP+ P T PP+ Sbjct: 208 KASPAAAPRSVATPTGIPTPSTSASPPT 235 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 161,461 Number of Sequences: 336 Number of extensions: 3420 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 24099889 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -