BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_T7_L08 (872 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC15F9.02 |seh1||nucleoporin Seh1 |Schizosaccharomyces pombe|c... 31 0.16 SPBC3F6.01c |||serine/threonine protein phosphatase |Schizosacch... 27 3.5 SPBC660.06 |||conserved fungal protein|Schizosaccharomyces pombe... 26 6.1 SPBC1604.12 |||sequence orphan|Schizosaccharomyces pombe|chr 2||... 26 6.1 >SPAC15F9.02 |seh1||nucleoporin Seh1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 339 Score = 31.5 bits (68), Expect = 0.16 Identities = 15/45 (33%), Positives = 20/45 (44%) Frame = +3 Query: 294 LRVHHLAAGGGGTREGELIPLRTYPSPPSRGLEKGFCSTTAPXRW 428 LR++ G T + + PSPPSR + FC P RW Sbjct: 137 LRIYEAMEPGNLTYWTLMNEIALMPSPPSRNEQPAFCVNWCPSRW 181 >SPBC3F6.01c |||serine/threonine protein phosphatase |Schizosaccharomyces pombe|chr 2|||Manual Length = 473 Score = 27.1 bits (57), Expect = 3.5 Identities = 15/35 (42%), Positives = 21/35 (60%) Frame = -3 Query: 366 DRCGEG*ALPLSFRHLLLRDGVLAEVEHRLPGLID 262 +R +G LPL F + +LRD L E+ + P LID Sbjct: 171 ERFCQGKKLPLKFAYSILRD--LKELLEKTPSLID 203 >SPBC660.06 |||conserved fungal protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 273 Score = 26.2 bits (55), Expect = 6.1 Identities = 9/20 (45%), Positives = 10/20 (50%) Frame = +2 Query: 569 GSGPAGYSGTPAALSGRPDG 628 G GP G+ G P G P G Sbjct: 227 GGGPGGFEGGPGGFGGGPGG 246 >SPBC1604.12 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 860 Score = 26.2 bits (55), Expect = 6.1 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = -1 Query: 479 AASTPSSRPLTFTGGKPPSXRG 414 A STP + P++ G PPS G Sbjct: 79 AGSTPKTTPVSLNAGVPPSNTG 100 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,761,064 Number of Sequences: 5004 Number of extensions: 50718 Number of successful extensions: 174 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 165 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 174 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 436477420 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -