BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_T7_L04 (800 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ621748-1|CAF21851.1| 228|Tribolium castaneum zinc finger tran... 23 2.8 AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor ... 21 8.7 >AJ621748-1|CAF21851.1| 228|Tribolium castaneum zinc finger transcription factor protein. Length = 228 Score = 23.0 bits (47), Expect = 2.8 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = +3 Query: 330 LGPVFHSQPSRAKSLGRR*MRSDSG 404 L P+FHS R S + SDSG Sbjct: 114 LSPLFHSAAPRTASRETKSSESDSG 138 >AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor protein protein. Length = 585 Score = 21.4 bits (43), Expect = 8.7 Identities = 11/36 (30%), Positives = 19/36 (52%), Gaps = 1/36 (2%) Frame = +3 Query: 72 CRTASQQSRSSCVVAARQY-VLSGVTSWKGNLASLQ 176 C T +++++CV QY L GV W G + ++ Sbjct: 103 CSTNPCENQATCVQNKNQYQCLCGV-GWTGKVCDVE 137 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 181,388 Number of Sequences: 336 Number of extensions: 3954 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21791490 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -