BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_T7_K23 (815 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954257-10|CAJ14161.1| 519|Anopheles gambiae Sply, Sphingosine... 27 0.91 DQ182017-1|ABA56309.1| 383|Anopheles gambiae G(alpha)s protein. 24 6.4 AF080563-1|AAC31943.1| 310|Anopheles gambiae Ultrabithorax home... 24 6.4 AF080562-1|AAC31942.1| 327|Anopheles gambiae Ultrabithorax home... 24 6.4 AJ276487-1|CAB90819.1| 375|Anopheles gambiae serine protease pr... 23 8.5 AB090815-2|BAC57906.1| 973|Anopheles gambiae reverse transcript... 23 8.5 >CR954257-10|CAJ14161.1| 519|Anopheles gambiae Sply, Sphingosine-phosphate lyase protein. Length = 519 Score = 26.6 bits (56), Expect = 0.91 Identities = 18/56 (32%), Positives = 27/56 (48%), Gaps = 2/56 (3%) Frame = -1 Query: 272 KKRIITLRKSLRVHTKR--AALEKINLKFIDTSSKFGHGRFQTPADKAAFMGTLKK 111 KK++ L + + +R A +EKIN FI S+ G+ + P D LKK Sbjct: 53 KKKVFKLARLIPAVRRRVDAEIEKINAGFIKDISQTGNYYTELPHDSMGQAEILKK 108 >DQ182017-1|ABA56309.1| 383|Anopheles gambiae G(alpha)s protein. Length = 383 Score = 23.8 bits (49), Expect = 6.4 Identities = 14/31 (45%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Frame = -1 Query: 212 EKINLKFIDTSSKFGH-GRFQTPADKAAFMG 123 EKI S FG R+QTPAD MG Sbjct: 288 EKIKAGKSKLSDYFGEFNRYQTPADAVCEMG 318 >AF080563-1|AAC31943.1| 310|Anopheles gambiae Ultrabithorax homeotic protein IVa protein. Length = 310 Score = 23.8 bits (49), Expect = 6.4 Identities = 17/43 (39%), Positives = 19/43 (44%), Gaps = 1/43 (2%) Frame = -3 Query: 192 H*HLVQVRSWSIPDAG*QG-CIHGYTQEGSYSRRSCGYHNPSG 67 H H + S DA Q C Y EGSYS + CG SG Sbjct: 56 HLHQTRTAQESPYDASIQAACKQIY--EGSYSSKDCGTKGTSG 96 >AF080562-1|AAC31942.1| 327|Anopheles gambiae Ultrabithorax homeotic protein IIa protein. Length = 327 Score = 23.8 bits (49), Expect = 6.4 Identities = 17/43 (39%), Positives = 19/43 (44%), Gaps = 1/43 (2%) Frame = -3 Query: 192 H*HLVQVRSWSIPDAG*QG-CIHGYTQEGSYSRRSCGYHNPSG 67 H H + S DA Q C Y EGSYS + CG SG Sbjct: 56 HLHQTRTAQESPYDASIQAACKQIY--EGSYSSKDCGTKGTSG 96 >AJ276487-1|CAB90819.1| 375|Anopheles gambiae serine protease protein. Length = 375 Score = 23.4 bits (48), Expect = 8.5 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = -3 Query: 441 YRIGQGIHKKDGKVIKNNASTEYDL 367 YR+ G+H D +I+ A EY++ Sbjct: 203 YRVNAGVHVNDIVLIELAADVEYNV 227 >AB090815-2|BAC57906.1| 973|Anopheles gambiae reverse transcriptase protein. Length = 973 Score = 23.4 bits (48), Expect = 8.5 Identities = 24/101 (23%), Positives = 38/101 (37%) Frame = +3 Query: 63 SSRWGCGSRSFFANTILLECTHECSLVSRRLESTMTELGRGVNEFEVDLF*CSPLCMHTQ 242 ++ WG S + N +L E +LV + T + R +DL CSP + Sbjct: 125 ATEWGSKSTNARGNAVL-EHFSRLNLVLVNVGFCPTFV-RNSRTSIIDLTFCSPALASSM 182 Query: 243 RLSKSNDTLFRSHAATLXSSQSRCLLHHNGGNLPSV*WISQ 365 SN H ++ S+C G P+ W +Q Sbjct: 183 NWRVSNAYTLSDHRVIRYTAGSKCHRVAQGSGFPA--WKTQ 221 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 758,113 Number of Sequences: 2352 Number of extensions: 15809 Number of successful extensions: 33 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 32 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 33 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 86487024 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -