BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_T7_K18 (842 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_02_0892 - 12218803-12218864,12219395-12219740 31 1.5 01_06_0581 - 30386018-30386440 29 4.6 >03_02_0892 - 12218803-12218864,12219395-12219740 Length = 135 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/32 (43%), Positives = 17/32 (53%) Frame = -2 Query: 682 RYRAKTRGRGGSSRGNVPDVFPETAPRHTRWR 587 R RA+ G GGS G V D P P + +WR Sbjct: 81 RRRARDSGDGGSGAGIVHDYRPAVLPFYEKWR 112 >01_06_0581 - 30386018-30386440 Length = 140 Score = 29.1 bits (62), Expect = 4.6 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = +1 Query: 274 SGVRSQVLERLEMRLRSGGGGARRQ 348 SG+ +V +R+E R GGGG RR+ Sbjct: 31 SGIEVKVRKRVEKEARMGGGGRRRR 55 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,890,738 Number of Sequences: 37544 Number of extensions: 196593 Number of successful extensions: 762 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 744 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 761 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2338704516 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -