BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_T7_K18 (842 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. 25 2.9 EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calc... 24 5.0 AJ439353-4|CAD27926.1| 338|Anopheles gambiae putative hox prote... 24 5.0 AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-sign... 24 5.0 AY745220-1|AAU93487.1| 101|Anopheles gambiae cytochrome P450 pr... 23 8.8 AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-conta... 23 8.8 AF020851-1|AAC31864.1| 214|Anopheles gambiae unknown protein. 23 8.8 AF020850-1|AAC31863.1| 214|Anopheles gambiae unknown protein. 23 8.8 AF020849-1|AAC31862.1| 214|Anopheles gambiae unknown protein. 23 8.8 >CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. Length = 1664 Score = 25.0 bits (52), Expect = 2.9 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = +3 Query: 564 HHGEHXAGRQRVCRGAVSGKTSG 632 H+G+H +G+ G+ SGK G Sbjct: 1259 HYGDHSSGKDPTGAGSSSGKGGG 1281 >EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calcium channel alpha2-delta subunit 1 protein. Length = 1256 Score = 24.2 bits (50), Expect = 5.0 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +2 Query: 56 FYNITSQEHGTSIRGRGCSMDPLDC 130 F NITS+ ++ + C+ D LDC Sbjct: 930 FINITSKCTASTTCKKNCASDELDC 954 >AJ439353-4|CAD27926.1| 338|Anopheles gambiae putative hox protein protein. Length = 338 Score = 24.2 bits (50), Expect = 5.0 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = +3 Query: 549 EQKQEHHGEHXAGRQRVCRG 608 EQ+Q+ HG+H R C G Sbjct: 278 EQQQQQHGQHCCCRGSHCGG 297 >AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-signaling promoter protein. Length = 1197 Score = 24.2 bits (50), Expect = 5.0 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = +3 Query: 549 EQKQEHHGEHXAGRQRVCRGAVS 617 +Q+Q+H EH GR+++ + S Sbjct: 156 QQQQQHQLEHNGGREQMMKNETS 178 >AY745220-1|AAU93487.1| 101|Anopheles gambiae cytochrome P450 protein. Length = 101 Score = 23.4 bits (48), Expect = 8.8 Identities = 12/31 (38%), Positives = 14/31 (45%) Frame = +1 Query: 67 YVPGARHFHPRSWLQYGSLRL*KDRVGAGQK 159 Y P F P WL+ G L+ AGQK Sbjct: 12 YFPEPDRFVPERWLKRGELKEHSGCPHAGQK 42 >AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-containing phosphoprotein protein. Length = 1200 Score = 23.4 bits (48), Expect = 8.8 Identities = 12/28 (42%), Positives = 14/28 (50%) Frame = +1 Query: 268 SGSGVRSQVLERLEMRLRSGGGGARRQR 351 +GSG RS+ R R RSG R R Sbjct: 1091 AGSGSRSRSRSRSRSRSRSGSAKGSRSR 1118 >AF020851-1|AAC31864.1| 214|Anopheles gambiae unknown protein. Length = 214 Score = 23.4 bits (48), Expect = 8.8 Identities = 11/37 (29%), Positives = 16/37 (43%) Frame = -1 Query: 326 PLRSLISNLSNTCDLTPLPEWSCEQSAWWGACGRVLD 216 PL L SN ++ P P W + + CG + D Sbjct: 128 PLGILPSNQRSSSSSKPTPCWESNKDVFPKPCGNLTD 164 >AF020850-1|AAC31863.1| 214|Anopheles gambiae unknown protein. Length = 214 Score = 23.4 bits (48), Expect = 8.8 Identities = 11/37 (29%), Positives = 16/37 (43%) Frame = -1 Query: 326 PLRSLISNLSNTCDLTPLPEWSCEQSAWWGACGRVLD 216 PL L SN ++ P P W + + CG + D Sbjct: 128 PLGILPSNQRSSSSSKPTPCWESNKDVFPKPCGNLTD 164 >AF020849-1|AAC31862.1| 214|Anopheles gambiae unknown protein. Length = 214 Score = 23.4 bits (48), Expect = 8.8 Identities = 11/37 (29%), Positives = 16/37 (43%) Frame = -1 Query: 326 PLRSLISNLSNTCDLTPLPEWSCEQSAWWGACGRVLD 216 PL L SN ++ P P W + + CG + D Sbjct: 128 PLGILPSNQRSSSSSKPTPCWESNKDVFPKPCGNLTD 164 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 442,418 Number of Sequences: 2352 Number of extensions: 5710 Number of successful extensions: 27 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 25 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 27 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 89305416 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -