BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_T7_K16 (806 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_04_0232 + 21130122-21130454,21130895-21131053,21131424-211315... 33 0.35 07_03_1140 - 24258627-24258849,24259967-24260089,24260200-242609... 31 0.82 06_03_1055 - 27234824-27234838,27236087-27236125,27236322-272373... 31 1.4 07_03_0846 - 21983581-21986055 29 3.3 05_04_0396 - 20934444-20934969,20935042-20935316,20935447-20935581 29 3.3 03_05_0183 - 21681673-21682524 29 4.4 08_02_0104 + 12404890-12405129,12405244-12405333,12405953-124060... 29 5.8 01_06_0695 - 31292622-31293317 28 7.6 >02_04_0232 + 21130122-21130454,21130895-21131053,21131424-21131582, 21132420-21132512,21133321-21133437,21133623-21133697, 21133878-21134104,21134200-21135073 Length = 678 Score = 32.7 bits (71), Expect = 0.35 Identities = 17/43 (39%), Positives = 20/43 (46%) Frame = +3 Query: 87 PSTTPRQERKSSTDYSEPRHRTELYPDLRSRDARVKKKTDSID 215 PS TP ER S+D PR Y R+RD K+ S D Sbjct: 365 PSDTPHLERSQSSDRRRPRSSDPRYTPSRTRDEDAHKQHSSRD 407 >07_03_1140 - 24258627-24258849,24259967-24260089,24260200-24260921, 24260945-24261073,24261484-24261714 Length = 475 Score = 31.5 bits (68), Expect = 0.82 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = +1 Query: 655 CHKPVIPGGTFLAPLAKTL 711 C KP+IP GT +APL K + Sbjct: 307 CRKPIIPSGTMVAPLVKKI 325 >06_03_1055 - 27234824-27234838,27236087-27236125,27236322-27237388, 27237422-27237630,27237650-27238053 Length = 577 Score = 30.7 bits (66), Expect = 1.4 Identities = 16/45 (35%), Positives = 27/45 (60%) Frame = -2 Query: 355 ASLAESGKDMLTVEPRESGGSKQCDFTSRVSHSKRETRRRSPFGS 221 A+ A +GK + E E S+QCD T + +S RE ++R+P+ + Sbjct: 430 AAAAAAGKPISEHEAIEHLWSRQCDLTEILQNSSRE-KKRNPYAA 473 >07_03_0846 - 21983581-21986055 Length = 824 Score = 29.5 bits (63), Expect = 3.3 Identities = 19/50 (38%), Positives = 26/50 (52%) Frame = +3 Query: 213 DLRDPNGLRRRVSRFECETRLVKSHCLEPPDSRGSTVSISLPDSARLASA 362 DL+D G +R +C+T S PD S VS+ LPD+A+ A A Sbjct: 326 DLQDFTGGCKRNVPLQCQTN--SSSAQTQPDKFYSMVSVRLPDNAQSAVA 373 >05_04_0396 - 20934444-20934969,20935042-20935316,20935447-20935581 Length = 311 Score = 29.5 bits (63), Expect = 3.3 Identities = 16/34 (47%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Frame = -2 Query: 442 GHLVHALGR-AAGGAKLPSAGLCLNASKAEASLA 344 G LV L R GG SAG+C S+ +ASLA Sbjct: 203 GRLVETLARDGGGGGGAYSAGVCFYGSRMDASLA 236 >03_05_0183 - 21681673-21682524 Length = 283 Score = 29.1 bits (62), Expect = 4.4 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = -2 Query: 655 SQAFIATLLFDPSMSALPIIAKQNSPS 575 SQAF A LL D + +A+P++ Q P+ Sbjct: 229 SQAFSAVLLADANRAAIPVVVVQKRPA 255 >08_02_0104 + 12404890-12405129,12405244-12405333,12405953-12406036, 12406888-12407132,12409032-12409095,12409270-12409968, 12410063-12410176,12410287-12410418,12410594-12410770, 12411085-12411138,12411230-12411292,12411396-12412307, 12412408-12412535,12413680-12413962 Length = 1094 Score = 28.7 bits (61), Expect = 5.8 Identities = 20/64 (31%), Positives = 27/64 (42%) Frame = +3 Query: 24 SSDESPGAGLSLNRSQHDAALPSTTPRQERKSSTDYSEPRHRTELYPDLRSRDARVKKKT 203 S +SPG L R HD +L KSST + R E SR +KT Sbjct: 731 SEADSPGDSL---RDVHDISLNLKLSLDSEKSSTKENSVRRNLEDAVQKLSRGVSANRKT 787 Query: 204 DSID 215 +S++ Sbjct: 788 ESVE 791 >01_06_0695 - 31292622-31293317 Length = 231 Score = 28.3 bits (60), Expect = 7.6 Identities = 16/45 (35%), Positives = 18/45 (40%) Frame = +3 Query: 39 PGAGLSLNRSQHDAALPSTTPRQERKSSTDYSEPRHRTELYPDLR 173 P L Q D PS++ SST S P HR L P R Sbjct: 3 PSTKQLLPMPQQDPNSPSSSTSSSSSSSTSPSHPHHRAPLPPSPR 47 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,372,299 Number of Sequences: 37544 Number of extensions: 484551 Number of successful extensions: 1426 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 1390 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1426 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2197677108 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -