BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_T7_K15 (807 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF364132-1|AAL35508.1| 397|Anopheles gambiae putative odorant r... 27 0.52 AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative different... 25 2.1 AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. 24 4.8 AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine pr... 24 4.8 AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22... 24 4.8 AY187044-1|AAO39758.1| 87|Anopheles gambiae putative antennal ... 24 6.3 >AF364132-1|AAL35508.1| 397|Anopheles gambiae putative odorant receptor Or4 protein. Length = 397 Score = 27.5 bits (58), Expect = 0.52 Identities = 16/41 (39%), Positives = 24/41 (58%), Gaps = 3/41 (7%) Frame = +3 Query: 486 FLIFLLPVSI--GY-CNLSPDSVLFILLCLSTGTCLLYTQV 599 F++ +LPV + GY CNL + +C S G C LYT++ Sbjct: 189 FVLIMLPVVVMCGYVCNLK-----VMTICCSIGHCTLYTRM 224 >AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative differentiation regulator protein. Length = 1283 Score = 25.4 bits (53), Expect = 2.1 Identities = 17/60 (28%), Positives = 28/60 (46%), Gaps = 1/60 (1%) Frame = -2 Query: 662 RKTSEREFIFDGE-ERMLAELNDLGIEEASPSGKAEKDKENRVRRKIAVPDGDWEEKDKE 486 R RE + E ER L E + E K +++KE R R++ + E+++KE Sbjct: 457 RAREAREAAIEREKERELREQREREQREKEQREKEQREKEERERQQREKEQREREQREKE 516 Score = 24.2 bits (50), Expect = 4.8 Identities = 18/83 (21%), Positives = 36/83 (43%) Frame = -2 Query: 626 EERMLAELNDLGIEEASPSGKAEKDKENRVRRKIAVPDGDWEEKDKEPADDLDNAKQSKP 447 EE A L + + E++KE +R + + E+++KE + + +Q + Sbjct: 445 EEHRAARLREEERAREAREAAIEREKERELREQREREQREKEQREKEQREKEERERQQRE 504 Query: 446 WYPRFEECLKTDAAWRDADAAHE 378 R E + + R+ +AA E Sbjct: 505 KEQREREQREKE---REREAARE 524 >AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. Length = 2259 Score = 24.2 bits (50), Expect = 4.8 Identities = 12/32 (37%), Positives = 21/32 (65%), Gaps = 2/32 (6%) Frame = -2 Query: 602 NDLGIEEASPSGKAEKDKEN-RVRRKI-AVPD 513 ND ++ G+ EKD+EN +RR++ ++PD Sbjct: 281 NDSASDKPDTDGEPEKDEENDDLRRELKSIPD 312 >AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine protease protein. Length = 1322 Score = 24.2 bits (50), Expect = 4.8 Identities = 19/56 (33%), Positives = 28/56 (50%), Gaps = 4/56 (7%) Frame = +2 Query: 428 PQSAGTRASI-ASHYPNRLRVPYLSPPSLHR---VLQSFS*LCSLYPSLPFHWDLP 583 P+++ +A+ A YP +R P P SLHR V+QS +Y +LP P Sbjct: 469 PKASRAQATTTAKPYPVYIRPPSRQPESLHRDPDVVQSVQ--RPVYVALPLEQTTP 522 >AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22D protein. Length = 1322 Score = 24.2 bits (50), Expect = 4.8 Identities = 19/56 (33%), Positives = 28/56 (50%), Gaps = 4/56 (7%) Frame = +2 Query: 428 PQSAGTRASI-ASHYPNRLRVPYLSPPSLHR---VLQSFS*LCSLYPSLPFHWDLP 583 P+++ +A+ A YP +R P P SLHR V+QS +Y +LP P Sbjct: 468 PKASRAQATTTAKPYPVYIRPPSRQPESLHRDPDVVQSVQ--RPVYVALPLEQTTP 521 >AY187044-1|AAO39758.1| 87|Anopheles gambiae putative antennal carrier protein AP-2 protein. Length = 87 Score = 23.8 bits (49), Expect = 6.3 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -2 Query: 563 AEKDKENRVRRKIAVPDGDWEEKDKEPADDLDNA 462 A KD ++V+ K A+PD +KD D +A Sbjct: 26 AAKDATDKVKDKAALPDAPKLDKDAVTTPDPKDA 59 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 721,159 Number of Sequences: 2352 Number of extensions: 13845 Number of successful extensions: 46 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 44 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 46 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 85239615 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -