BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_T7_K15 (807 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 24 1.9 DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholi... 22 7.7 DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholi... 22 7.7 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 23.8 bits (49), Expect = 1.9 Identities = 17/50 (34%), Positives = 19/50 (38%) Frame = +1 Query: 94 PIPRPGSPRSGESCDFFLSPPGAIWKPPTGAFPGLSELKNSVLQAKSSAS 243 P P+P SP SPP PP G PG +N S AS Sbjct: 21 PGPQP-SPHQSPQAPQRGSPPNPSQGPPPGGPPGAPPSQNPSQMMISPAS 69 >DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 21.8 bits (44), Expect = 7.7 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = -1 Query: 204 FRESRESSGRWLPNGTRGREE 142 F +R SSGR L RG+E+ Sbjct: 366 FETNRYSSGRVLMRTVRGKEK 386 >DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 21.8 bits (44), Expect = 7.7 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = -1 Query: 204 FRESRESSGRWLPNGTRGREE 142 F +R SSGR L RG+E+ Sbjct: 366 FETNRYSSGRVLMRTVRGKEK 386 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 197,473 Number of Sequences: 438 Number of extensions: 4287 Number of successful extensions: 32 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 32 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 25610547 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -