BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_T7_K13 (770 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY273778-1|AAP33487.1| 427|Apis mellifera ultraspiracle protein... 25 0.78 AF263459-1|AAF73057.1| 427|Apis mellifera ultraspiracle protein... 25 0.78 DQ667182-1|ABG75734.1| 445|Apis mellifera GABA-gated chloride c... 23 3.1 DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride c... 23 3.1 EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. 22 5.5 EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. 22 5.5 AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 22 7.3 AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 22 7.3 EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. 21 9.6 EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. 21 9.6 >AY273778-1|AAP33487.1| 427|Apis mellifera ultraspiracle protein protein. Length = 427 Score = 25.0 bits (52), Expect = 0.78 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = +3 Query: 384 TTSQRWSRGSTPRSLSTSRANNHHIKP 464 T +Q WSRG+T SL S + + P Sbjct: 18 TQAQHWSRGNTWLSLDNSNMSMSSVGP 44 >AF263459-1|AAF73057.1| 427|Apis mellifera ultraspiracle protein protein. Length = 427 Score = 25.0 bits (52), Expect = 0.78 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = +3 Query: 384 TTSQRWSRGSTPRSLSTSRANNHHIKP 464 T +Q WSRG+T SL S + + P Sbjct: 18 TQAQHWSRGNTWLSLDNSNMSMSSVGP 44 >DQ667182-1|ABG75734.1| 445|Apis mellifera GABA-gated chloride channel protein. Length = 445 Score = 23.0 bits (47), Expect = 3.1 Identities = 7/14 (50%), Positives = 10/14 (71%) Frame = -1 Query: 62 CINTLHWLIILHES 21 C N ++W+I LH S Sbjct: 418 CFNLMYWIIYLHIS 431 >DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride channel protein. Length = 445 Score = 23.0 bits (47), Expect = 3.1 Identities = 7/14 (50%), Positives = 10/14 (71%) Frame = -1 Query: 62 CINTLHWLIILHES 21 C N ++W+I LH S Sbjct: 418 CFNLMYWIIYLHIS 431 >EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. Length = 684 Score = 22.2 bits (45), Expect = 5.5 Identities = 10/33 (30%), Positives = 18/33 (54%) Frame = -2 Query: 421 RGVLPRDQRWDVVVDLFFYRDPEESEKDEQQAK 323 R +LPR ++ + LF Y P SE ++ ++ Sbjct: 603 RLLLPRGKKEGMPFQLFLYVSPVSSEYNQYNSR 635 >EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. Length = 684 Score = 22.2 bits (45), Expect = 5.5 Identities = 10/33 (30%), Positives = 18/33 (54%) Frame = -2 Query: 421 RGVLPRDQRWDVVVDLFFYRDPEESEKDEQQAK 323 R +LPR ++ + LF Y P SE ++ ++ Sbjct: 603 RLLLPRGKKEGMPFQLFLYVSPVSSEYNQYNSR 635 >AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform A protein. Length = 782 Score = 21.8 bits (44), Expect = 7.3 Identities = 6/30 (20%), Positives = 16/30 (53%) Frame = -2 Query: 607 VLDPAQDHQPITEASYVNIPVIALCNTDSP 518 ++DP ++++ E + IP++ + P Sbjct: 167 IVDPVEENETYDEFDTIRIPIVRSLSKSPP 196 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 21.8 bits (44), Expect = 7.3 Identities = 9/38 (23%), Positives = 16/38 (42%) Frame = -2 Query: 349 SEKDEQQAKEQXXXXXXXXXXXXVHEDWNETLEPVASW 236 +++ +QQ ++Q + W EP ASW Sbjct: 437 AQQPQQQQQQQQQQQQQQQQQQQQQQHWPMEEEPAASW 474 >EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. Length = 686 Score = 21.4 bits (43), Expect = 9.6 Identities = 6/18 (33%), Positives = 13/18 (72%) Frame = -1 Query: 497 YPMQHQVFPLYWFDVVVV 444 +P ++++P Y+FD V+ Sbjct: 159 FPAIYEIYPNYFFDSSVI 176 >EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. Length = 686 Score = 21.4 bits (43), Expect = 9.6 Identities = 6/18 (33%), Positives = 13/18 (72%) Frame = -1 Query: 497 YPMQHQVFPLYWFDVVVV 444 +P ++++P Y+FD V+ Sbjct: 159 FPAIYEIYPNYFFDSSVI 176 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 186,941 Number of Sequences: 438 Number of extensions: 3757 Number of successful extensions: 12 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24154023 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -