BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_T7_K09 (808 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC033821-1|AAH33821.1| 616|Homo sapiens chromosome 16 open read... 33 1.2 BC032400-1|AAH32400.1| 553|Homo sapiens C16orf44 protein protein. 33 1.2 DQ986374-1|ABJ15760.1| 447|Homo sapiens T-box transcription fac... 33 1.6 AK074056-1|BAB84882.1| 296|Homo sapiens FLJ00127 protein protein. 33 1.6 AK022605-1|BAB14124.1| 616|Homo sapiens protein ( Homo sapiens ... 32 2.1 AB033111-1|BAA86599.1| 785|Homo sapiens KIAA1285 protein protein. 31 3.7 AK127846-1|BAC87158.1| 483|Homo sapiens protein ( Homo sapiens ... 30 8.6 >BC033821-1|AAH33821.1| 616|Homo sapiens chromosome 16 open reading frame 44 protein. Length = 616 Score = 33.1 bits (72), Expect = 1.2 Identities = 16/33 (48%), Positives = 20/33 (60%) Frame = +3 Query: 582 RTPSSTASGD*WKWMLSLGWLVYGIGGFDDRVD 680 R P +TA G W M SLG +Y IGG DD ++ Sbjct: 476 RRPMTTARG--WHSMCSLGDSIYSIGGSDDNIE 506 >BC032400-1|AAH32400.1| 553|Homo sapiens C16orf44 protein protein. Length = 553 Score = 33.1 bits (72), Expect = 1.2 Identities = 16/33 (48%), Positives = 20/33 (60%) Frame = +3 Query: 582 RTPSSTASGD*WKWMLSLGWLVYGIGGFDDRVD 680 R P +TA G W M SLG +Y IGG DD ++ Sbjct: 413 RRPMTTARG--WHSMCSLGDSIYSIGGSDDNIE 443 >DQ986374-1|ABJ15760.1| 447|Homo sapiens T-box transcription factor TBX20 isoform A protein. Length = 447 Score = 32.7 bits (71), Expect = 1.6 Identities = 14/42 (33%), Positives = 24/42 (57%) Frame = -1 Query: 706 PPSPAXSDTSTRSSNPPIPYTNHPRLNIHFHQSPDAVLEGVR 581 P +P+ +S + S P P + PR + +F Q P A ++G+R Sbjct: 396 PLTPSAIASSMQGSGPTFPSFHMPRYHHYFQQGPYAAIQGLR 437 >AK074056-1|BAB84882.1| 296|Homo sapiens FLJ00127 protein protein. Length = 296 Score = 32.7 bits (71), Expect = 1.6 Identities = 16/33 (48%), Positives = 20/33 (60%) Frame = +3 Query: 582 RTPSSTASGD*WKWMLSLGWLVYGIGGFDDRVD 680 R P +TA G W M SLG +Y IGG DD ++ Sbjct: 156 RRPMTTARG--WHSMSSLGDSIYSIGGSDDNIE 186 >AK022605-1|BAB14124.1| 616|Homo sapiens protein ( Homo sapiens cDNA FLJ12543 fis, clone NT2RM4000590, weakly similar to RING CANAL PROTEIN. ). Length = 616 Score = 32.3 bits (70), Expect = 2.1 Identities = 16/33 (48%), Positives = 20/33 (60%) Frame = +3 Query: 582 RTPSSTASGD*WKWMLSLGWLVYGIGGFDDRVD 680 R P +TA G W M SLG +Y IGG DD ++ Sbjct: 476 RRPMTTARG--WHSMCSLGDGIYSIGGSDDNIE 506 >AB033111-1|BAA86599.1| 785|Homo sapiens KIAA1285 protein protein. Length = 785 Score = 31.5 bits (68), Expect = 3.7 Identities = 15/57 (26%), Positives = 28/57 (49%) Frame = -2 Query: 720 PYASSHPPLRXRIHQPDHQIPRFHTPTTPDLTSISINPLTPY*KEFAPGLKPPLSSE 550 P A++ + H P HQ H+P P+ ++++P P + P L+ P+S + Sbjct: 132 PPAAAEQEVSLLSHSPHHQEAPVHSPEAPEKDPLTLSPTVPE-TDMDPLLQSPVSQK 187 >AK127846-1|BAC87158.1| 483|Homo sapiens protein ( Homo sapiens cDNA FLJ45949 fis, clone PLACE7007973. ). Length = 483 Score = 30.3 bits (65), Expect = 8.6 Identities = 13/47 (27%), Positives = 22/47 (46%) Frame = -1 Query: 712 IKPPSPAXSDTSTRSSNPPIPYTNHPRLNIHFHQSPDAVLEGVRAGV 572 + PP P +T + PP P + + L++H S G R+G+ Sbjct: 125 VNPPQPPLPETKEKEQAPPAPSSLYRTLSLHGSASTYTRPSGPRSGI 171 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 111,491,197 Number of Sequences: 237096 Number of extensions: 2438081 Number of successful extensions: 10336 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 9748 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10334 length of database: 76,859,062 effective HSP length: 89 effective length of database: 55,757,518 effective search space used: 9980595722 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -