BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_T7_K09 (808 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z46791-5|CAA86755.2| 948|Caenorhabditis elegans Hypothetical pr... 29 3.0 AF100656-3|AAF99968.1| 265|Caenorhabditis elegans Hypothetical ... 28 6.8 AL117195-31|CAN99709.1| 1459|Caenorhabditis elegans Hypothetical... 28 9.0 AL117195-30|CAB60772.3| 1456|Caenorhabditis elegans Hypothetical... 28 9.0 >Z46791-5|CAA86755.2| 948|Caenorhabditis elegans Hypothetical protein C09G5.6 protein. Length = 948 Score = 29.5 bits (63), Expect = 3.0 Identities = 13/43 (30%), Positives = 15/43 (34%) Frame = -2 Query: 723 RPYASSHPPLRXRIHQPDHQIPRFHTPTTPDLTSISINPLTPY 595 RPY PP H + + P P T NP PY Sbjct: 172 RPYPPQQPPSTSAPHSSPNNRTSLYNPQPPPKTGYPTNPRVPY 214 >AF100656-3|AAF99968.1| 265|Caenorhabditis elegans Hypothetical protein F49F1.1 protein. Length = 265 Score = 28.3 bits (60), Expect = 6.8 Identities = 11/41 (26%), Positives = 23/41 (56%) Frame = -2 Query: 663 IPRFHTPTTPDLTSISINPLTPY*KEFAPGLKPPLSSEAPS 541 +P T TP+LT++++ P+T K + P +++ P+ Sbjct: 173 VPLVLTTLTPELTTVTVEPITSTLKPTTTTITPTTTTKLPT 213 >AL117195-31|CAN99709.1| 1459|Caenorhabditis elegans Hypothetical protein Y57A10A.18b protein. Length = 1459 Score = 27.9 bits (59), Expect = 9.0 Identities = 11/25 (44%), Positives = 17/25 (68%) Frame = -2 Query: 564 PLSSEAPSAYLTPSSLGMXKGVSPP 490 P+++EAP+A PS + +G SPP Sbjct: 1203 PVAAEAPAAAAAPSRARVPRGPSPP 1227 >AL117195-30|CAB60772.3| 1456|Caenorhabditis elegans Hypothetical protein Y57A10A.18a protein. Length = 1456 Score = 27.9 bits (59), Expect = 9.0 Identities = 11/25 (44%), Positives = 17/25 (68%) Frame = -2 Query: 564 PLSSEAPSAYLTPSSLGMXKGVSPP 490 P+++EAP+A PS + +G SPP Sbjct: 1203 PVAAEAPAAAAAPSRARVPRGPSPP 1227 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,957,585 Number of Sequences: 27780 Number of extensions: 355584 Number of successful extensions: 1205 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1137 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1201 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1977346024 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -