BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_T7_K05 (804 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_01_0427 + 3274817-3274901,3275587-3275697,3275979-3276283,327... 141 7e-34 12_01_0435 + 3428552-3428636,3429242-3429352,3429434-3429738,342... 134 1e-31 03_05_1096 - 30364144-30365310,30365825-30365971,30366087-303663... 29 3.3 07_01_0761 + 5849466-5850677 29 5.7 06_03_0915 - 25929433-25930893 29 5.7 12_01_0582 - 4752576-4752786,4752955-4753037,4753324-4753530,475... 28 7.6 03_05_0901 + 28635672-28636094,28637623-28637802,28637903-286381... 28 10.0 >11_01_0427 + 3274817-3274901,3275587-3275697,3275979-3276283, 3276406-3276815,3276942-3277200 Length = 389 Score = 141 bits (341), Expect = 7e-34 Identities = 63/91 (69%), Positives = 73/91 (80%) Frame = -1 Query: 393 ASTEYDLSEKSITPMGGFPHYGEVNNDFVMIKGCCMGPKKRIITLRKSLRVHTKRAALEK 214 A TE+D +EK ITPMGGFPHYG V D++MIKGCC+GPKKR++TLR+SL T R ALE+ Sbjct: 298 ACTEFDRTEKDITPMGGFPHYGVVKGDYLMIKGCCVGPKKRVVTLRQSLLKQTSRLALEE 357 Query: 213 INLKFIDTSSKFGHGRFQTPADKAAFMGTLK 121 I LKFIDTSSKFGHGRFQT +K F G LK Sbjct: 358 IKLKFIDTSSKFGHGRFQTTDEKQRFFGKLK 388 Score = 98.3 bits (234), Expect = 6e-21 Identities = 50/106 (47%), Positives = 65/106 (61%) Frame = -3 Query: 754 IQLNXGTIEDKVKWAREHLENLSLSILCLPKMK*LTALVSPRAKDTKVSLLVGTQRSYPV 575 IQ+N GTI DKV + + E K + + + + K + + P Sbjct: 184 IQINGGTIADKVDYGYKFFEKEIPVDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLPR 243 Query: 574 RHTKGLRKVACIGAWHPSRVSFTVARAGQKGYHHRTEMNKKIYRIG 437 + +GLRKVACIGAWHP+RVS+TVARAGQ GYHHRTEMNKK+Y+IG Sbjct: 244 KTHRGLRKVACIGAWHPARVSYTVARAGQNGYHHRTEMNKKVYKIG 289 >12_01_0435 + 3428552-3428636,3429242-3429352,3429434-3429738, 3429821-3430230,3430323-3430556,3430934-3431378, 3432300-3432390,3433292-3433518,3433786-3433861, 3434009-3434134,3434221-3434384 Length = 757 Score = 134 bits (323), Expect = 1e-31 Identities = 59/83 (71%), Positives = 69/83 (83%) Frame = -1 Query: 393 ASTEYDLSEKSITPMGGFPHYGEVNNDFVMIKGCCMGPKKRIITLRKSLRVHTKRAALEK 214 A TE+D +EK ITPMGGFPHYG V D++MIKGCC+GPKKR++TLR+SL T R ALE+ Sbjct: 298 ACTEFDRTEKDITPMGGFPHYGVVKGDYLMIKGCCVGPKKRVVTLRQSLLKQTSRLALEE 357 Query: 213 INLKFIDTSSKFGHGRFQTPADK 145 I LKFIDTSSKFGHGRFQT +K Sbjct: 358 IKLKFIDTSSKFGHGRFQTTDEK 380 Score = 98.3 bits (234), Expect = 6e-21 Identities = 50/106 (47%), Positives = 65/106 (61%) Frame = -3 Query: 754 IQLNXGTIEDKVKWAREHLENLSLSILCLPKMK*LTALVSPRAKDTKVSLLVGTQRSYPV 575 IQ+N GTI DKV + + E K + + + + K + + P Sbjct: 184 IQINGGTIADKVDYGYKFFEKEIPVDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLPR 243 Query: 574 RHTKGLRKVACIGAWHPSRVSFTVARAGQKGYHHRTEMNKKIYRIG 437 + +GLRKVACIGAWHP+RVS+TVARAGQ GYHHRTEMNKK+Y+IG Sbjct: 244 KTHRGLRKVACIGAWHPARVSYTVARAGQNGYHHRTEMNKKVYKIG 289 >03_05_1096 - 30364144-30365310,30365825-30365971,30366087-30366393, 30366541-30366849,30367544-30370567,30370640-30372290, 30372373-30373463,30373544-30373646,30373737-30374439, 30374654-30375783,30375913-30376027,30376504-30376695, 30377443-30377616,30378438-30378494,30378581-30378716, 30378842-30378927,30379023-30379092,30379993-30380021, 30380444-30380456,30380762-30381006 Length = 3582 Score = 29.5 bits (63), Expect = 3.3 Identities = 10/32 (31%), Positives = 18/32 (56%) Frame = -1 Query: 378 DLSEKSITPMGGFPHYGEVNNDFVMIKGCCMG 283 D + + +P+GG P YG ++ D + C +G Sbjct: 1371 DPTSAAASPIGGIPRYGRLSGDVYVCNQCTIG 1402 >07_01_0761 + 5849466-5850677 Length = 403 Score = 28.7 bits (61), Expect = 5.7 Identities = 17/50 (34%), Positives = 22/50 (44%), Gaps = 2/50 (4%) Frame = -3 Query: 613 VSLLVGTQRSYPVRHTKGLRKVACI--GAWHPSRVSFTVARAGQKGYHHR 470 V+LLVG R V V+ + G HP SFT+ RA H+ Sbjct: 129 VALLVGNDRRLRVLDAAASAAVSLVPDGEHHPINCSFTLGRAASSSGEHK 178 >06_03_0915 - 25929433-25930893 Length = 486 Score = 28.7 bits (61), Expect = 5.7 Identities = 13/45 (28%), Positives = 22/45 (48%) Frame = +1 Query: 337 GETSHRCNGFLRQIILSRCIVFNNFAILFVDSLVQYDRFSCSFQY 471 GE H+ G I+ C++ NN +L V ++ D S S ++ Sbjct: 138 GEVVHKALGRPASIVAQMCVIINNAGVLIVYLIIIGDVMSGSLKH 182 >12_01_0582 - 4752576-4752786,4752955-4753037,4753324-4753530, 4755128-4755207,4756853-4756998,4757088-4757719 Length = 452 Score = 28.3 bits (60), Expect = 7.6 Identities = 11/44 (25%), Positives = 22/44 (50%) Frame = +2 Query: 350 IGVMDFSDRSYSVDALFLITLPSFLWIPWSNTIDFLVHFSTVMI 481 + +DF + ++ +L LPS W W + + + VH ++ I Sbjct: 392 LSAIDFLKHAADLNTRWLKRLPSNFWATWVHPLTYKVHVKSLWI 435 >03_05_0901 + 28635672-28636094,28637623-28637802,28637903-28638172, 28638506-28638757,28639205-28639453,28639533-28639606, 28639798-28639915,28640421-28640555,28640813-28640965 Length = 617 Score = 27.9 bits (59), Expect = 10.0 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = -3 Query: 502 ARAGQKGYHHRTEMNKKIYRIGPRNPQ 422 +RA GY + +E N +IYR+ R+P+ Sbjct: 590 SRADNLGYEYMSEQNNEIYRLLLRDPK 616 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,285,614 Number of Sequences: 37544 Number of extensions: 482959 Number of successful extensions: 1168 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1125 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1164 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2185924824 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -