BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_T7_J21 (816 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL031632-7|CAA21009.2| 1528|Caenorhabditis elegans Hypothetical ... 29 5.3 Z93387-2|CAB07650.1| 763|Caenorhabditis elegans Hypothetical pr... 28 9.2 Z70680-3|CAA94575.1| 1263|Caenorhabditis elegans Hypothetical pr... 28 9.2 U43562-1|AAC47411.1| 1263|Caenorhabditis elegans DPY-26 protein. 28 9.2 >AL031632-7|CAA21009.2| 1528|Caenorhabditis elegans Hypothetical protein Y32B12B.4 protein. Length = 1528 Score = 28.7 bits (61), Expect = 5.3 Identities = 19/48 (39%), Positives = 24/48 (50%), Gaps = 1/48 (2%) Frame = -2 Query: 284 NVTLLVAFR-IQNARRDVEAHLDRGNRCYRFFS*HVHHGSEGPDITQF 144 N L+AF + A+ D EAHL+ NRC R H G +I QF Sbjct: 1134 NEKFLLAFALVLRAKYDHEAHLNLVNRCMRNVC-KTHFGETVDEIFQF 1180 >Z93387-2|CAB07650.1| 763|Caenorhabditis elegans Hypothetical protein T02E9.3 protein. Length = 763 Score = 27.9 bits (59), Expect = 9.2 Identities = 21/74 (28%), Positives = 34/74 (45%), Gaps = 2/74 (2%) Frame = -1 Query: 441 FGHLVHALGRAAGGAKLPSAGLCLNASKAEASLAESGKDMLTVEPRESGGSKQCDFTSRV 262 FG L H G LP + S+ + ++++G + R+SGGSK+ + Sbjct: 212 FGQLTHRGGERERRHSLPRVIIEEVRSRRGSRMSQTGSQSGSPTRRQSGGSKERSPSQPD 271 Query: 261 SH--SKRETRRRSP 226 H +K + R RSP Sbjct: 272 IHIVAKPQQRWRSP 285 >Z70680-3|CAA94575.1| 1263|Caenorhabditis elegans Hypothetical protein C25G4.5 protein. Length = 1263 Score = 27.9 bits (59), Expect = 9.2 Identities = 21/74 (28%), Positives = 29/74 (39%) Frame = +2 Query: 98 RQERKSSTDYSEPRHRTELYPDLRSRDARVKKKTDSIDFRDPNGLRRRVSRFECETRLVK 277 R KS+ D +E PD ++ D R + + + N R+V C T L Sbjct: 1076 RSPNKSNHDVNETMKALTEMPDYQAADERPNNQPTTSTYGTANTENRKVHINGCHTLL-- 1133 Query: 278 SHCLEPPDSRGSTV 319 S L P G TV Sbjct: 1134 SLALSMPSRMGETV 1147 >U43562-1|AAC47411.1| 1263|Caenorhabditis elegans DPY-26 protein. Length = 1263 Score = 27.9 bits (59), Expect = 9.2 Identities = 21/74 (28%), Positives = 29/74 (39%) Frame = +2 Query: 98 RQERKSSTDYSEPRHRTELYPDLRSRDARVKKKTDSIDFRDPNGLRRRVSRFECETRLVK 277 R KS+ D +E PD ++ D R + + + N R+V C T L Sbjct: 1076 RSPNKSNHDVNETMKALTEMPDYQAADERPNNQPTTSTYGTANTENRKVHINGCHTLL-- 1133 Query: 278 SHCLEPPDSRGSTV 319 S L P G TV Sbjct: 1134 SLALSMPSRMGETV 1147 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,984,616 Number of Sequences: 27780 Number of extensions: 401745 Number of successful extensions: 1146 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1091 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1146 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 2008899418 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -