BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_T7_J19 (797 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_11396| Best HMM Match : Ribosomal_S2 (HMM E-Value=0) 182 3e-46 SB_24578| Best HMM Match : rve (HMM E-Value=4.8e-35) 36 0.038 SB_57493| Best HMM Match : Surf_Ag_VNR (HMM E-Value=0.00037) 31 1.4 SB_49472| Best HMM Match : BDS_I_II (HMM E-Value=1.5) 30 2.5 SB_40833| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_4542| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_8061| Best HMM Match : Homeobox (HMM E-Value=5.1e-27) 29 4.4 SB_726| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_51220| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.8 SB_50413| Best HMM Match : GRP (HMM E-Value=0.15) 29 5.8 >SB_11396| Best HMM Match : Ribosomal_S2 (HMM E-Value=0) Length = 328 Score = 182 bits (443), Expect = 3e-46 Identities = 92/152 (60%), Positives = 107/152 (70%) Frame = -3 Query: 780 ENPX*XVXXFXHGPFGQGCCXEXXPRTXGXTXIAGRFTTRCFY*XRSKLHFREPXLLIVL 601 ENP V P+GQ + T G T IAGRFT F + + FREP LLIV Sbjct: 69 ENPA-DVCVISARPYGQRAILKYASHT-GATPIAGRFTPGTFT-NQIQAAFREPRLLIVC 125 Query: 600 DPAQDHQPITEASYVNIPVIALCNTDSPLRFVDIAIPCNTKSSHSIGLMWWLLAREVLRL 421 DP DHQP+TEASYVNIPVIA CNTDSPLR VD+AIPCN K HSIGLM+WLLAREVLR+ Sbjct: 126 DPRIDHQPVTEASYVNIPVIAFCNTDSPLRHVDVAIPCNNKGIHSIGLMFWLLAREVLRM 185 Query: 420 RGVLPRDQRWDVVVDLFFYRDPEESEKDEQQA 325 RG + R W+++ DL+FYRDPEE+EK+EQ A Sbjct: 186 RGSISRALPWEIMPDLYFYRDPEEAEKEEQAA 217 >SB_24578| Best HMM Match : rve (HMM E-Value=4.8e-35) Length = 1772 Score = 35.9 bits (79), Expect = 0.038 Identities = 24/67 (35%), Positives = 33/67 (49%), Gaps = 4/67 (5%) Frame = +2 Query: 374 KSTTTSQRWSRGSTPRSLNTSRANNHHIKPIEWEDLVLHGIAMST-NLSGE---SVLHKA 541 K+TT RWS+G TP ++ H I L+ HG ST NL+ E VL++ Sbjct: 1396 KTTTDKTRWSKGQTPNGKVAQKSKFQH--GIAGTQLIYHGTGPSTKNLTTEQAKQVLNEN 1453 Query: 542 ITGMLTY 562 G +TY Sbjct: 1454 ELGTMTY 1460 >SB_57493| Best HMM Match : Surf_Ag_VNR (HMM E-Value=0.00037) Length = 432 Score = 30.7 bits (66), Expect = 1.4 Identities = 15/32 (46%), Positives = 22/32 (68%) Frame = -3 Query: 603 LDPAQDHQPITEASYVNIPVIALCNTDSPLRF 508 LDP +HQPIT+ + I ++A TD+PL+F Sbjct: 119 LDPDVEHQPITDRAEACICLVA---TDAPLKF 147 >SB_49472| Best HMM Match : BDS_I_II (HMM E-Value=1.5) Length = 315 Score = 29.9 bits (64), Expect = 2.5 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -3 Query: 471 HSIGLMWWLLAREVLRLRGVLP 406 H G +WW+L E LR + VLP Sbjct: 46 HDDGSVWWVLTSESLRAKAVLP 67 >SB_40833| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1300 Score = 29.5 bits (63), Expect = 3.3 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = -2 Query: 610 DCIGPCTRPSTHY*SFICQHSCDCFVQHRLPTKICGHCYP 491 DCI C+ PS F C+ +C T++C +C+P Sbjct: 883 DCI-TCSDPSNALIGFTCKANCTPGQFKNTATRVCENCHP 921 >SB_4542| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 987 Score = 29.5 bits (63), Expect = 3.3 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = -2 Query: 196 SCFWSTPCSRRMVCPGTR*VEHNCRRTSRRHRSA 95 +C W+ P R+ PG R H T+R H +A Sbjct: 904 TCSWALPAHYRVHVPGQRSASHEAFDTTRPHENA 937 >SB_8061| Best HMM Match : Homeobox (HMM E-Value=5.1e-27) Length = 418 Score = 29.1 bits (62), Expect = 4.4 Identities = 15/41 (36%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = +3 Query: 369 RTNQPQHPSAGHGEA-HHEASTLHVPTTTTSNQ*SGKTWCC 488 R QP H ++ + A HH A LH P +TS + W C Sbjct: 176 RDGQPCHGASMNNFAYHHAADFLHYPPVSTSYMPAHPYWTC 216 >SB_726| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 29.1 bits (62), Expect = 4.4 Identities = 17/66 (25%), Positives = 29/66 (43%), Gaps = 3/66 (4%) Frame = +2 Query: 362 R*KNKSTTTSQRWSRGSTPRSLNTSRANNHHIKPIEWEDL---VLHGIAMSTNLSGESVL 532 R N+ T ++ STP + N+ ++P EW ++ H + L+GES Sbjct: 3 RGSNRRPTFKYKFGDSSTPFYSALKKQNDRSMRPWEWHEMKARYSHAQTLINALTGESKY 62 Query: 533 HKAITG 550 +TG Sbjct: 63 EFTLTG 68 >SB_51220| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1601 Score = 28.7 bits (61), Expect = 5.8 Identities = 15/41 (36%), Positives = 23/41 (56%) Frame = +2 Query: 413 TPRSLNTSRANNHHIKPIEWEDLVLHGIAMSTNLSGESVLH 535 T +SLN S N + P EW + V+ G+ LSG ++L+ Sbjct: 864 TAQSLNVSVDNLKFLAPTEWRE-VIPGLKQEILLSGSNMLN 903 >SB_50413| Best HMM Match : GRP (HMM E-Value=0.15) Length = 487 Score = 28.7 bits (61), Expect = 5.8 Identities = 17/51 (33%), Positives = 25/51 (49%), Gaps = 1/51 (1%) Frame = +1 Query: 361 TVEEQINHNIPALVTGKHTTKPQHFTCQQPPHQTNRVGR-LGVAWDSNVHK 510 +V Q+ + P +T HT+ T P HQ + +GR G DSNV + Sbjct: 241 SVTNQMRGHEPRSITYNHTSITAPLTTGYPDHQGSYMGRYAGSVADSNVSR 291 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,668,549 Number of Sequences: 59808 Number of extensions: 430359 Number of successful extensions: 1052 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 946 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1048 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2203769656 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -