BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_T7_J13 (798 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292359-1|CAL23171.2| 436|Tribolium castaneum gustatory recept... 26 0.40 AM292370-1|CAL23182.1| 418|Tribolium castaneum gustatory recept... 23 3.7 AM292335-1|CAL23147.2| 374|Tribolium castaneum gustatory recept... 23 3.7 DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 21 8.6 >AM292359-1|CAL23171.2| 436|Tribolium castaneum gustatory receptor candidate 38 protein. Length = 436 Score = 25.8 bits (54), Expect = 0.40 Identities = 13/47 (27%), Positives = 23/47 (48%), Gaps = 3/47 (6%) Frame = -2 Query: 635 TCIRPVMTYASVVFAHAARTHLKSLQVIQSRF--CRI-AVGAPWFLR 504 T + P++ +V H H K +QV+ + C I +G WF++ Sbjct: 189 TVVLPLLACGVMVVTHITMAHFKIIQVVPYCYINCLIYLIGGFWFMQ 235 >AM292370-1|CAL23182.1| 418|Tribolium castaneum gustatory receptor candidate 49 protein. Length = 418 Score = 22.6 bits (46), Expect = 3.7 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = +3 Query: 330 LWATSTVYHSVYWVGYVISSGY 395 L+ +T+ V W GYVI + Y Sbjct: 277 LFEITTITAMVMWFGYVIDTMY 298 >AM292335-1|CAL23147.2| 374|Tribolium castaneum gustatory receptor candidate 14 protein. Length = 374 Score = 22.6 bits (46), Expect = 3.7 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = +3 Query: 330 LWATSTVYHSVYWVGYVISSGY 395 L+ +T+ V W GYVI + Y Sbjct: 233 LFEITTITAMVMWFGYVIDTMY 254 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 21.4 bits (43), Expect = 8.6 Identities = 12/38 (31%), Positives = 17/38 (44%) Frame = +1 Query: 67 TLVGELAGLNRRVANTDPSKSSASLNLPPXSETRPTEK 180 T VG L A+ +S +N+PP PT+K Sbjct: 671 THVGNYTCLASNSASVTTYTTSLFINVPPRWILEPTDK 708 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 162,238 Number of Sequences: 336 Number of extensions: 3315 Number of successful extensions: 6 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21687721 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -