BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_T7_J13 (798 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_7946| Best HMM Match : DUF434 (HMM E-Value=7.5) 38 0.009 SB_58983| Best HMM Match : Integrin_alpha (HMM E-Value=2.7) 37 0.016 SB_19427| Best HMM Match : RVT_1 (HMM E-Value=7.5e-32) 37 0.016 SB_51334| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.022 SB_31424| Best HMM Match : Sigma54_activat (HMM E-Value=6.2) 37 0.022 SB_16447| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.050 SB_35779| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.088 SB_10126| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.088 SB_24816| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.12 SB_19530| Best HMM Match : EMI (HMM E-Value=3.5) 34 0.12 SB_40344| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.12 SB_30264| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.12 SB_18909| Best HMM Match : RVT_1 (HMM E-Value=1.2e-28) 34 0.12 SB_12192| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.12 SB_40765| Best HMM Match : DX (HMM E-Value=1.4) 34 0.15 SB_23320| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_12008| Best HMM Match : RVT_1 (HMM E-Value=0) 34 0.15 SB_49600| Best HMM Match : RVT_1 (HMM E-Value=0) 33 0.20 SB_43828| Best HMM Match : XPG_N (HMM E-Value=1.8) 33 0.20 SB_26135| Best HMM Match : RVT_1 (HMM E-Value=0.072) 33 0.20 SB_2897| Best HMM Match : RVT_1 (HMM E-Value=3e-33) 33 0.20 SB_1793| Best HMM Match : RVT_1 (HMM E-Value=0) 33 0.20 SB_462| Best HMM Match : RVT_1 (HMM E-Value=7.7e-25) 33 0.20 SB_43541| Best HMM Match : RVT_1 (HMM E-Value=0) 33 0.20 SB_38808| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.20 SB_29272| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.20 SB_20120| Best HMM Match : RVT_1 (HMM E-Value=0) 33 0.20 SB_18871| Best HMM Match : RVT_1 (HMM E-Value=0) 33 0.20 SB_33932| Best HMM Match : RVT_1 (HMM E-Value=1.3e-19) 33 0.27 SB_2234| Best HMM Match : RVT_1 (HMM E-Value=1.3e-19) 33 0.27 SB_58595| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_57671| Best HMM Match : RVT_1 (HMM E-Value=0) 33 0.35 SB_53749| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_53367| Best HMM Match : RVT_1 (HMM E-Value=0) 33 0.35 SB_17007| Best HMM Match : VWA (HMM E-Value=4.6e-06) 33 0.35 SB_13193| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.35 SB_12291| Best HMM Match : Exo_endo_phos (HMM E-Value=1.8e-09) 33 0.35 SB_6954| Best HMM Match : RVT_1 (HMM E-Value=0) 33 0.35 SB_49175| Best HMM Match : RVT_1 (HMM E-Value=1.8e-32) 33 0.35 SB_26221| Best HMM Match : RVT_1 (HMM E-Value=1.6e-24) 33 0.35 SB_11838| Best HMM Match : RVT_1 (HMM E-Value=0) 33 0.35 SB_11114| Best HMM Match : UPF0203 (HMM E-Value=9.6) 33 0.35 SB_30161| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.47 SB_58751| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.62 SB_34884| Best HMM Match : RVT_1 (HMM E-Value=8.1e-25) 32 0.62 SB_10379| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.82 SB_25515| Best HMM Match : Complex1_LYR (HMM E-Value=9.6) 31 0.82 SB_4872| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_33068| Best HMM Match : Galactosyl_T (HMM E-Value=5.9e-37) 31 1.1 SB_49429| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_43617| Best HMM Match : RVT_1 (HMM E-Value=3e-21) 31 1.4 SB_43127| Best HMM Match : DUF1690 (HMM E-Value=2.2) 31 1.4 SB_34112| Best HMM Match : RVT_1 (HMM E-Value=0.041) 31 1.4 SB_32197| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_31373| Best HMM Match : Put_DNA-bind_N (HMM E-Value=8.4) 31 1.4 SB_31120| Best HMM Match : Pox_F16 (HMM E-Value=5) 31 1.4 SB_30875| Best HMM Match : Rubredoxin (HMM E-Value=1.6) 31 1.4 SB_25871| Best HMM Match : SLH (HMM E-Value=1.1) 31 1.4 SB_15881| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_6495| Best HMM Match : RVT_1 (HMM E-Value=1.2e-17) 31 1.4 SB_4935| Best HMM Match : Pox_F16 (HMM E-Value=5.3) 31 1.4 SB_4770| Best HMM Match : Exo_endo_phos (HMM E-Value=0.031) 31 1.4 SB_56531| Best HMM Match : SLH (HMM E-Value=1.1) 31 1.4 SB_54752| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_52464| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_51257| Best HMM Match : Pox_F16 (HMM E-Value=4.1) 31 1.4 SB_43623| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_30407| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_28762| Best HMM Match : RVT_1 (HMM E-Value=3.9e-23) 31 1.4 SB_20783| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_18046| Best HMM Match : RVT_1 (HMM E-Value=0.34) 31 1.4 SB_16492| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_11572| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_11516| Best HMM Match : Lectin_C (HMM E-Value=2.9) 31 1.4 SB_9954| Best HMM Match : SLH (HMM E-Value=1.1) 31 1.4 SB_8726| Best HMM Match : Pox_F16 (HMM E-Value=5.2) 31 1.4 SB_58764| Best HMM Match : Sex_peptide (HMM E-Value=5.7) 30 1.9 SB_56417| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.9 SB_44720| Best HMM Match : Helicase_C (HMM E-Value=0.59) 30 1.9 SB_41825| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.9 SB_35765| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.9 SB_32837| Best HMM Match : RVT_1 (HMM E-Value=8.3e-17) 30 1.9 SB_27763| Best HMM Match : VapD_N (HMM E-Value=10) 30 1.9 SB_59287| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.9 SB_42738| Best HMM Match : 7tm_1 (HMM E-Value=0.89) 30 1.9 SB_39804| Best HMM Match : VapD_N (HMM E-Value=10) 30 1.9 SB_30760| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.9 SB_4883| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.9 SB_207| Best HMM Match : RVT_1 (HMM E-Value=7.4e-06) 30 1.9 SB_54561| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.5 SB_28982| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.5 SB_19117| Best HMM Match : XPG_N (HMM E-Value=1.8) 30 2.5 SB_43973| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.5 SB_41541| Best HMM Match : RVT_1 (HMM E-Value=3.1e-17) 30 2.5 SB_35242| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.5 SB_50942| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_7179| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_53893| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_39569| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_31184| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_7051| Best HMM Match : RVT_1 (HMM E-Value=0.064) 29 4.4 SB_53402| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_32094| Best HMM Match : RVT_1 (HMM E-Value=1.9e-12) 29 4.4 SB_15386| Best HMM Match : CSE2 (HMM E-Value=0.18) 29 4.4 SB_45989| Best HMM Match : TFIIE_alpha (HMM E-Value=5) 29 5.8 SB_42093| Best HMM Match : RVT_1 (HMM E-Value=2.5e-20) 29 5.8 SB_40417| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.8 SB_38350| Best HMM Match : OCIA (HMM E-Value=6.7) 29 5.8 SB_36411| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.8 SB_33952| Best HMM Match : Lectin_C (HMM E-Value=3.1) 29 5.8 SB_28572| Best HMM Match : RVT_1 (HMM E-Value=2e-20) 29 5.8 SB_27289| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.8 SB_25338| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.8 SB_21287| Best HMM Match : Lectin_C (HMM E-Value=3.1) 29 5.8 SB_15993| Best HMM Match : RVT_1 (HMM E-Value=7.2e-12) 29 5.8 SB_8874| Best HMM Match : PhaG_MnhG_YufB (HMM E-Value=2.4) 29 5.8 SB_59269| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.8 SB_50382| Best HMM Match : RVT_1 (HMM E-Value=0.026) 29 5.8 SB_24162| Best HMM Match : RVT_1 (HMM E-Value=0) 29 5.8 SB_49650| Best HMM Match : RVT_1 (HMM E-Value=1.3) 28 7.6 SB_45959| Best HMM Match : DUF1091 (HMM E-Value=3.6) 28 7.6 SB_36917| Best HMM Match : RinB (HMM E-Value=2.2) 28 7.6 SB_29434| Best HMM Match : Peptidase_A17 (HMM E-Value=3.1e-25) 28 7.6 SB_48151| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.6 SB_45899| Best HMM Match : Exo_endo_phos (HMM E-Value=0.011) 28 7.6 SB_41542| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.6 SB_38372| Best HMM Match : RVT_1 (HMM E-Value=0) 28 7.6 >SB_7946| Best HMM Match : DUF434 (HMM E-Value=7.5) Length = 294 Score = 37.9 bits (84), Expect = 0.009 Identities = 39/136 (28%), Positives = 57/136 (41%), Gaps = 4/136 (2%) Frame = -2 Query: 674 ANCPSAIR*LLYKTCIRPVMTYASVVFAHAARTHLKSLQVIQSRFCRIAVG----APWFL 507 +NCP I+ YK+ + P + YAS + + H+K ++ +Q R R P + Sbjct: 135 SNCPENIKEAAYKSLVLPHLEYASSAWDPWLKKHVKQIEKVQRRAGRFVTNCWDRTPGTV 194 Query: 506 RNVXXXXXXXXXXXSKYLQSASLRHFEKAARHENPLIVAAGNYIPDPVDRMVNRRRRPKH 327 N+ SK Q+A L F KA ++ L IPD +DR R+ R H Sbjct: 195 TNI--LNDLEWPPLSKRRQNARLTLFYKAVNKKSAL------EIPDNIDRR-TRQLRSSH 245 Query: 326 VITDPPDPLTVLLGTT 279 PD L TT Sbjct: 246 -----PDKFIELCPTT 256 >SB_58983| Best HMM Match : Integrin_alpha (HMM E-Value=2.7) Length = 237 Score = 37.1 bits (82), Expect = 0.016 Identities = 34/120 (28%), Positives = 50/120 (41%), Gaps = 4/120 (3%) Frame = -2 Query: 674 ANCPSAIR*LLYKTCIRPVMTYASVVFAHAARTHLKSLQVIQSRFCRIAVG----APWFL 507 +NCP + YKT + P + YAS + + H+K ++ +Q R R P + Sbjct: 108 SNCPETFKEAAYKTLVLPHLEYASSAWDPWLKKHVKQIEKVQRRAGRFVKNCWDRTPGTV 167 Query: 506 RNVXXXXXXXXXXXSKYLQSASLRHFEKAARHENPLIVAAGNYIPDPVDRMVNRRRRPKH 327 N+ SK Q A L F KA ++ L IPD +DR R+ R H Sbjct: 168 TNI--LNDLEWPPLSKRRQDARLTLFYKAVNKKSAL------EIPDNIDRR-TRQLRSSH 218 >SB_19427| Best HMM Match : RVT_1 (HMM E-Value=7.5e-32) Length = 698 Score = 37.1 bits (82), Expect = 0.016 Identities = 32/116 (27%), Positives = 50/116 (43%), Gaps = 4/116 (3%) Frame = -2 Query: 674 ANCPSAIR*LLYKTCIRPVMTYASVVFAHAARTHLKSLQVIQSRFCRIAVG----APWFL 507 +NCP+ I+ YK+ + P + YAS + + H+K ++ +Q R R P + Sbjct: 541 SNCPANIKEAAYKSLVHPHLEYASSAWDPWLKKHVKQIEKVQRRAGRFVKNCWDRTPGTV 600 Query: 506 RNVXXXXXXXXXXXSKYLQSASLRHFEKAARHENPLIVAAGNYIPDPVDRMVNRRR 339 N+ SK Q A L F KA ++ L IPD +DR + R Sbjct: 601 TNI--LNDLEWPPLSKRRQDARLTLFYKAVNKKSAL------KIPDNIDRRTRQLR 648 >SB_51334| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1402 Score = 36.7 bits (81), Expect = 0.022 Identities = 34/120 (28%), Positives = 52/120 (43%), Gaps = 4/120 (3%) Frame = -2 Query: 674 ANCPSAIR*LLYKTCIRPVMTYASVVFAHAARTHLKSLQVIQSRFCRIAVG----APWFL 507 +NCP+ I+ YK+ + P + YAS + + H+K ++ +Q R R P + Sbjct: 806 SNCPANIKEAAYKSLVLPHLEYASSAWDPWLKKHVKQIEKVQRRSGRFVKNCWDRTPGTV 865 Query: 506 RNVXXXXXXXXXXXSKYLQSASLRHFEKAARHENPLIVAAGNYIPDPVDRMVNRRRRPKH 327 N+ SK Q A L F KA ++ L IPD +DR R+ R H Sbjct: 866 TNI--LNDLEWPPLSKRRQDARLTLFYKAVNKKSAL------KIPDNIDRR-TRQLRSSH 916 >SB_31424| Best HMM Match : Sigma54_activat (HMM E-Value=6.2) Length = 263 Score = 36.7 bits (81), Expect = 0.022 Identities = 34/121 (28%), Positives = 52/121 (42%), Gaps = 4/121 (3%) Frame = -2 Query: 674 ANCPSAIR*LLYKTCIRPVMTYASVVFAHAARTHLKSLQVIQSRFCRIAVG----APWFL 507 +NCP I+ YK+ + P + YAS + + H+K ++ +Q R R P + Sbjct: 128 SNCPENIKEAAYKSLVLPHLEYASSAWDPWLKKHVKQIEKVQRRAGRFVKNCWDRTPGTV 187 Query: 506 RNVXXXXXXXXXXXSKYLQSASLRHFEKAARHENPLIVAAGNYIPDPVDRMVNRRRRPKH 327 N+ SK Q A L F KA ++ L IPD +DR R+ R H Sbjct: 188 TNI--LNDLEWPPLSKRRQDARLTLFYKAVNKKSAL------EIPDNIDRR-TRQLRSSH 238 Query: 326 V 324 + Sbjct: 239 L 239 >SB_16447| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 949 Score = 35.5 bits (78), Expect = 0.050 Identities = 19/39 (48%), Positives = 25/39 (64%) Frame = -2 Query: 647 LLYKTCIRPVMTYASVVFAHAARTHLKSLQVIQSRFCRI 531 L+Y + IR V+ YASVVFA+ + SL+ IQ R RI Sbjct: 709 LVYCSLIRSVIEYASVVFANLPQYLANSLEAIQKRALRI 747 >SB_35779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 305 Score = 34.7 bits (76), Expect = 0.088 Identities = 12/50 (24%), Positives = 30/50 (60%) Frame = -2 Query: 674 ANCPSAIR*LLYKTCIRPVMTYASVVFAHAARTHLKSLQVIQSRFCRIAV 525 ++CP+A++ YK +RP++ Y + ++ + ++ ++ +Q C+I V Sbjct: 243 SSCPAAVKEQAYKALVRPLVEYGTEAWSPHTKKDIQKVESVQRPRCQICV 292 >SB_10126| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 523 Score = 34.7 bits (76), Expect = 0.088 Identities = 17/38 (44%), Positives = 25/38 (65%), Gaps = 1/38 (2%) Frame = -2 Query: 641 YKTCIRPVMTYASVVFAHAARTHL-KSLQVIQSRFCRI 531 Y TCIRP+M YA VF ++ +L + L++I+ R RI Sbjct: 344 YLTCIRPIMEYACPVFHNSLPDYLSQDLEIIRRRALRI 381 >SB_24816| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 662 Score = 34.3 bits (75), Expect = 0.12 Identities = 15/48 (31%), Positives = 29/48 (60%), Gaps = 3/48 (6%) Frame = -2 Query: 668 CPSAIR*LLYKTCIRPVMTYASVVFAHAARTHLKSLQVIQ---SRFCR 534 CP +++ YKT +RP + YAS V++ + +++ +Q +RFC+ Sbjct: 507 CPESVKTQGYKTLVRPQLEYASTVWSPHQEYLIDAIEAVQKKAARFCK 554 >SB_19530| Best HMM Match : EMI (HMM E-Value=3.5) Length = 244 Score = 34.3 bits (75), Expect = 0.12 Identities = 15/48 (31%), Positives = 29/48 (60%), Gaps = 3/48 (6%) Frame = -2 Query: 668 CPSAIR*LLYKTCIRPVMTYASVVFAHAARTHLKSLQVIQ---SRFCR 534 CP +++ YKT +RP + YAS V++ + +++ +Q +RFC+ Sbjct: 89 CPESVKTQGYKTLVRPQLEYASTVWSPHQEYLIDAIEAVQKKAARFCK 136 >SB_40344| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 401 Score = 34.3 bits (75), Expect = 0.12 Identities = 14/44 (31%), Positives = 26/44 (59%) Frame = -2 Query: 674 ANCPSAIR*LLYKTCIRPVMTYASVVFAHAARTHLKSLQVIQSR 543 +NCP+ I+ YK+ + P + YAS + + H+K ++ +Q R Sbjct: 244 SNCPANIKEAAYKSLVLPHLEYASSAWDPWLKKHVKQIEKVQRR 287 >SB_30264| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 689 Score = 34.3 bits (75), Expect = 0.12 Identities = 15/48 (31%), Positives = 29/48 (60%), Gaps = 3/48 (6%) Frame = -2 Query: 668 CPSAIR*LLYKTCIRPVMTYASVVFAHAARTHLKSLQVIQ---SRFCR 534 CP +++ YKT +RP + YAS V++ + +++ +Q +RFC+ Sbjct: 575 CPESVKTQGYKTLVRPQLEYASTVWSPHQEYLIDAIEAVQKKAARFCK 622 >SB_18909| Best HMM Match : RVT_1 (HMM E-Value=1.2e-28) Length = 591 Score = 34.3 bits (75), Expect = 0.12 Identities = 16/47 (34%), Positives = 25/47 (53%) Frame = -2 Query: 668 CPSAIR*LLYKTCIRPVMTYASVVFAHAARTHLKSLQVIQSRFCRIA 528 CP +R Y T +RP + +AS V+ + +K L+ +Q R R A Sbjct: 344 CPDFVRERAYTTLVRPRVEFASSVWDPHVQKQIKDLESVQRRAARFA 390 >SB_12192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1339 Score = 34.3 bits (75), Expect = 0.12 Identities = 19/40 (47%), Positives = 22/40 (55%), Gaps = 1/40 (2%) Frame = -2 Query: 647 LLYKTCIRPVMTYASVVFAHAARTHLKS-LQVIQSRFCRI 531 L Y TCIRPV YA VF H +L + L+ Q R RI Sbjct: 1224 LFYLTCIRPVTEYACPVFHHCLPQYLSNDLERCQKRALRI 1263 >SB_40765| Best HMM Match : DX (HMM E-Value=1.4) Length = 278 Score = 33.9 bits (74), Expect = 0.15 Identities = 15/48 (31%), Positives = 26/48 (54%), Gaps = 3/48 (6%) Frame = -2 Query: 671 NCPSAIR*LLYKTCIRPVMTYASVVFAHAARTHLKSLQVIQ---SRFC 537 NCP ++ Y +RP++ YAS + + + SL+ +Q +RFC Sbjct: 114 NCPQRVKVTAYTAIVRPMLEYASAAWDPHLKKDIASLEKVQRKAARFC 161 >SB_23320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1136 Score = 33.9 bits (74), Expect = 0.15 Identities = 15/39 (38%), Positives = 23/39 (58%), Gaps = 1/39 (2%) Frame = -2 Query: 641 YKTCIRPVMTYASVVFAHAARTHLK-SLQVIQSRFCRIA 528 Y TC+RP++ Y + +F H ++K L+ IQ R IA Sbjct: 641 YNTCVRPILEYCAPLFHHTIPAYVKEDLEHIQKRALSIA 679 >SB_12008| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 979 Score = 33.9 bits (74), Expect = 0.15 Identities = 14/44 (31%), Positives = 25/44 (56%) Frame = -2 Query: 674 ANCPSAIR*LLYKTCIRPVMTYASVVFAHAARTHLKSLQVIQSR 543 +NCP I+ YK+ + P + YAS + + H+K ++ +Q R Sbjct: 379 SNCPENIKEAAYKSLVLPHLEYASSAWDPWLKKHVKQIEKVQRR 422 >SB_49600| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1273 Score = 33.5 bits (73), Expect = 0.20 Identities = 15/48 (31%), Positives = 26/48 (54%), Gaps = 3/48 (6%) Frame = -2 Query: 671 NCPSAIR*LLYKTCIRPVMTYASVVFAHAARTHLKSLQVIQ---SRFC 537 NCP ++ Y +RP++ YAS + + + SL+ +Q +RFC Sbjct: 905 NCPQRVKVTAYTAIVRPMLEYASAAWDPHLQKDIASLEKVQRKAARFC 952 >SB_43828| Best HMM Match : XPG_N (HMM E-Value=1.8) Length = 174 Score = 33.5 bits (73), Expect = 0.20 Identities = 15/48 (31%), Positives = 26/48 (54%), Gaps = 3/48 (6%) Frame = -2 Query: 671 NCPSAIR*LLYKTCIRPVMTYASVVFAHAARTHLKSLQVIQ---SRFC 537 NCP ++ Y +RP++ YAS + + + SL+ +Q +RFC Sbjct: 10 NCPQRVKVTAYTAIVRPMLEYASAAWDPHLQKDIASLEKVQRKAARFC 57 >SB_26135| Best HMM Match : RVT_1 (HMM E-Value=0.072) Length = 375 Score = 33.5 bits (73), Expect = 0.20 Identities = 15/48 (31%), Positives = 26/48 (54%), Gaps = 3/48 (6%) Frame = -2 Query: 671 NCPSAIR*LLYKTCIRPVMTYASVVFAHAARTHLKSLQVIQ---SRFC 537 NCP ++ Y +RP++ YAS + + + SL+ +Q +RFC Sbjct: 211 NCPQRVKVTAYTAIVRPMLEYASAAWDPHLQKDIASLEKVQRKAARFC 258 >SB_2897| Best HMM Match : RVT_1 (HMM E-Value=3e-33) Length = 609 Score = 33.5 bits (73), Expect = 0.20 Identities = 15/48 (31%), Positives = 26/48 (54%), Gaps = 3/48 (6%) Frame = -2 Query: 671 NCPSAIR*LLYKTCIRPVMTYASVVFAHAARTHLKSLQVIQ---SRFC 537 NCP ++ Y +RP++ YAS + + + SL+ +Q +RFC Sbjct: 443 NCPQRVKVTAYTAIVRPMLEYASAAWDPHLQKDIASLEKVQRKAARFC 490 >SB_1793| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 864 Score = 33.5 bits (73), Expect = 0.20 Identities = 15/48 (31%), Positives = 26/48 (54%), Gaps = 3/48 (6%) Frame = -2 Query: 671 NCPSAIR*LLYKTCIRPVMTYASVVFAHAARTHLKSLQVIQ---SRFC 537 NCP ++ Y +RP++ YAS + + + SL+ +Q +RFC Sbjct: 627 NCPQRVKVTAYTAIVRPMLEYASAAWDPHLQKDIASLEKVQRKAARFC 674 >SB_462| Best HMM Match : RVT_1 (HMM E-Value=7.7e-25) Length = 863 Score = 33.5 bits (73), Expect = 0.20 Identities = 15/48 (31%), Positives = 26/48 (54%), Gaps = 3/48 (6%) Frame = -2 Query: 671 NCPSAIR*LLYKTCIRPVMTYASVVFAHAARTHLKSLQVIQ---SRFC 537 NCP ++ Y +RP++ YAS + + + SL+ +Q +RFC Sbjct: 729 NCPQRVKVTAYTAIVRPMLEYASAAWDPHLQKDIASLEKVQRKAARFC 776 >SB_43541| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 581 Score = 33.5 bits (73), Expect = 0.20 Identities = 15/48 (31%), Positives = 26/48 (54%), Gaps = 3/48 (6%) Frame = -2 Query: 671 NCPSAIR*LLYKTCIRPVMTYASVVFAHAARTHLKSLQVIQ---SRFC 537 NCP ++ Y +RP++ YAS + + + SL+ +Q +RFC Sbjct: 417 NCPQRVKVTAYTAIVRPMLEYASAAWDPHLQKDIASLEKVQRKAARFC 464 >SB_38808| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 824 Score = 33.5 bits (73), Expect = 0.20 Identities = 15/48 (31%), Positives = 26/48 (54%), Gaps = 3/48 (6%) Frame = -2 Query: 671 NCPSAIR*LLYKTCIRPVMTYASVVFAHAARTHLKSLQVIQ---SRFC 537 NCP ++ Y +RP++ YAS + + + SL+ +Q +RFC Sbjct: 660 NCPQRVKVTAYTAIVRPMLEYASAAWDPHLQKDIASLEKVQRKAARFC 707 >SB_29272| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 719 Score = 33.5 bits (73), Expect = 0.20 Identities = 15/48 (31%), Positives = 26/48 (54%), Gaps = 3/48 (6%) Frame = -2 Query: 671 NCPSAIR*LLYKTCIRPVMTYASVVFAHAARTHLKSLQVIQ---SRFC 537 NCP ++ Y +RP++ YAS + + + SL+ +Q +RFC Sbjct: 619 NCPQRVKVTAYTAIVRPMLEYASAAWDPHLQKDIASLEKVQRKAARFC 666 >SB_20120| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 666 Score = 33.5 bits (73), Expect = 0.20 Identities = 15/48 (31%), Positives = 26/48 (54%), Gaps = 3/48 (6%) Frame = -2 Query: 671 NCPSAIR*LLYKTCIRPVMTYASVVFAHAARTHLKSLQVIQ---SRFC 537 NCP ++ Y +RP++ YAS + + + SL+ +Q +RFC Sbjct: 502 NCPQRVKVTAYTAIVRPMLEYASAAWDPYLQKDIASLEKVQRKAARFC 549 >SB_18871| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 546 Score = 33.5 bits (73), Expect = 0.20 Identities = 15/48 (31%), Positives = 26/48 (54%), Gaps = 3/48 (6%) Frame = -2 Query: 671 NCPSAIR*LLYKTCIRPVMTYASVVFAHAARTHLKSLQVIQ---SRFC 537 NCP ++ Y +RP++ YAS + + + SL+ +Q +RFC Sbjct: 435 NCPQRVKVTAYTAIVRPMLEYASAAWDPHLQKDIASLEKVQRKAARFC 482 >SB_33932| Best HMM Match : RVT_1 (HMM E-Value=1.3e-19) Length = 541 Score = 33.1 bits (72), Expect = 0.27 Identities = 18/39 (46%), Positives = 24/39 (61%) Frame = -2 Query: 647 LLYKTCIRPVMTYASVVFAHAARTHLKSLQVIQSRFCRI 531 L+Y + IR V+ YASVVFA+ + L+ IQ R RI Sbjct: 427 LVYCSLIRSVIEYASVVFANLPQYLANYLEAIQKRALRI 465 >SB_2234| Best HMM Match : RVT_1 (HMM E-Value=1.3e-19) Length = 476 Score = 33.1 bits (72), Expect = 0.27 Identities = 18/39 (46%), Positives = 24/39 (61%) Frame = -2 Query: 647 LLYKTCIRPVMTYASVVFAHAARTHLKSLQVIQSRFCRI 531 L+Y + IR V+ YASVVFA+ + L+ IQ R RI Sbjct: 362 LVYCSLIRSVIEYASVVFANLPQYLANYLEAIQKRALRI 400 >SB_58595| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1462 Score = 32.7 bits (71), Expect = 0.35 Identities = 14/38 (36%), Positives = 25/38 (65%) Frame = -2 Query: 644 LYKTCIRPVMTYASVVFAHAARTHLKSLQVIQSRFCRI 531 LY + +RP + YAS V+A A T ++S++ +Q R ++ Sbjct: 859 LYLSIVRPTVGYASEVWAPQAITDMRSVEALQRRATKV 896 >SB_57671| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 533 Score = 32.7 bits (71), Expect = 0.35 Identities = 11/47 (23%), Positives = 28/47 (59%) Frame = -2 Query: 674 ANCPSAIR*LLYKTCIRPVMTYASVVFAHAARTHLKSLQVIQSRFCR 534 ++CP+A++ YK +RP++ Y + ++ + ++ ++ +Q R R Sbjct: 425 SSCPAAVKEQAYKALVRPLVEYGTEAWSPHTKKDIQKVESVQRRAAR 471 >SB_53749| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 32.7 bits (71), Expect = 0.35 Identities = 11/47 (23%), Positives = 28/47 (59%) Frame = -2 Query: 674 ANCPSAIR*LLYKTCIRPVMTYASVVFAHAARTHLKSLQVIQSRFCR 534 ++CP+A++ YK +RP++ Y + ++ + ++ ++ +Q R R Sbjct: 63 SSCPAAVKEQAYKALVRPLVEYGTEAWSPHTKKDIQKVESVQRRAAR 109 >SB_53367| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1025 Score = 32.7 bits (71), Expect = 0.35 Identities = 11/47 (23%), Positives = 28/47 (59%) Frame = -2 Query: 674 ANCPSAIR*LLYKTCIRPVMTYASVVFAHAARTHLKSLQVIQSRFCR 534 ++CP+A++ YK +RP++ Y + ++ + ++ ++ +Q R R Sbjct: 937 SSCPAAVKEQAYKALVRPLVEYGTEAWSPHTKKDIQKVESVQRRAAR 983 >SB_17007| Best HMM Match : VWA (HMM E-Value=4.6e-06) Length = 453 Score = 32.7 bits (71), Expect = 0.35 Identities = 11/47 (23%), Positives = 28/47 (59%) Frame = -2 Query: 674 ANCPSAIR*LLYKTCIRPVMTYASVVFAHAARTHLKSLQVIQSRFCR 534 ++CP+A++ YK +RP++ Y + ++ + ++ ++ +Q R R Sbjct: 335 SSCPAAVKEQAYKALVRPLVEYGTKAWSPHTKKDIQKVESVQRRAAR 381 >SB_13193| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 415 Score = 32.7 bits (71), Expect = 0.35 Identities = 22/69 (31%), Positives = 32/69 (46%) Frame = -1 Query: 282 HKHRSPSSSNPSLATKGSTSELTHRHSPLSFSPDLLSGSRFRXRW*IQRSTALARVSVSN 103 H+ +P S+ + T + ELTH +SP S + L RFR R +L + N Sbjct: 224 HRVPNPGESHEAEETSSESFELTHENSPRHISVEDLPKGRFRSR-------SLVHPATRN 276 Query: 102 SPVEPRELT 76 V+PR T Sbjct: 277 FAVKPRSGT 285 >SB_12291| Best HMM Match : Exo_endo_phos (HMM E-Value=1.8e-09) Length = 843 Score = 32.7 bits (71), Expect = 0.35 Identities = 11/47 (23%), Positives = 28/47 (59%) Frame = -2 Query: 674 ANCPSAIR*LLYKTCIRPVMTYASVVFAHAARTHLKSLQVIQSRFCR 534 ++CP+A++ YK +RP++ Y + ++ + ++ ++ +Q R R Sbjct: 664 SSCPAAVKEQAYKALVRPLVEYGTEAWSPHTKKDIQKVESVQRRAAR 710 >SB_6954| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 943 Score = 32.7 bits (71), Expect = 0.35 Identities = 14/38 (36%), Positives = 25/38 (65%) Frame = -2 Query: 644 LYKTCIRPVMTYASVVFAHAARTHLKSLQVIQSRFCRI 531 LY + +RP + YAS V+A A T ++S++ +Q R ++ Sbjct: 450 LYLSIVRPTVGYASEVWAPQAITDMRSVEALQRRATKV 487 >SB_49175| Best HMM Match : RVT_1 (HMM E-Value=1.8e-32) Length = 823 Score = 32.7 bits (71), Expect = 0.35 Identities = 11/47 (23%), Positives = 28/47 (59%) Frame = -2 Query: 674 ANCPSAIR*LLYKTCIRPVMTYASVVFAHAARTHLKSLQVIQSRFCR 534 ++CP+A++ YK +RP++ Y + ++ + ++ ++ +Q R R Sbjct: 417 SSCPAAVKEQAYKALVRPLVEYGTEAWSPHTKKDIQKVESVQRRAAR 463 >SB_26221| Best HMM Match : RVT_1 (HMM E-Value=1.6e-24) Length = 488 Score = 32.7 bits (71), Expect = 0.35 Identities = 14/38 (36%), Positives = 25/38 (65%) Frame = -2 Query: 644 LYKTCIRPVMTYASVVFAHAARTHLKSLQVIQSRFCRI 531 LY + +RP + YAS V+A A T ++S++ +Q R ++ Sbjct: 393 LYLSIVRPTVGYASEVWAPQAITDMRSVEALQRRATKV 430 >SB_11838| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1009 Score = 32.7 bits (71), Expect = 0.35 Identities = 11/47 (23%), Positives = 28/47 (59%) Frame = -2 Query: 674 ANCPSAIR*LLYKTCIRPVMTYASVVFAHAARTHLKSLQVIQSRFCR 534 ++CP+A++ YK +RP++ Y + ++ + ++ ++ +Q R R Sbjct: 869 SSCPAAVKEQAYKALVRPLVEYGTEAWSPHTKKDIQKVESVQRRAAR 915 >SB_11114| Best HMM Match : UPF0203 (HMM E-Value=9.6) Length = 197 Score = 32.7 bits (71), Expect = 0.35 Identities = 11/47 (23%), Positives = 28/47 (59%) Frame = -2 Query: 674 ANCPSAIR*LLYKTCIRPVMTYASVVFAHAARTHLKSLQVIQSRFCR 534 ++CP+A++ YK +RP++ Y + ++ + ++ ++ +Q R R Sbjct: 89 SSCPAAVKEQAYKALVRPLVEYGTEAWSPHTKKDIQKVESVQRRAAR 135 >SB_30161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 265 Score = 32.3 bits (70), Expect = 0.47 Identities = 11/47 (23%), Positives = 28/47 (59%) Frame = -2 Query: 674 ANCPSAIR*LLYKTCIRPVMTYASVVFAHAARTHLKSLQVIQSRFCR 534 ++CP+A++ YK +RP++ Y + ++ + ++ ++ +Q R R Sbjct: 157 SSCPAAVKEQAYKALVRPLVEYGTEAWSPHTQKDIQKVESVQRRAAR 203 >SB_58751| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 214 Score = 31.9 bits (69), Expect = 0.62 Identities = 11/45 (24%), Positives = 26/45 (57%) Frame = -2 Query: 668 CPSAIR*LLYKTCIRPVMTYASVVFAHAARTHLKSLQVIQSRFCR 534 CP+A++ YK +RP++ Y + ++ + ++ ++ +Q R R Sbjct: 144 CPAAVKEQAYKALVRPLVEYGTEAWSPHTKKDIQKVESVQRRAAR 188 >SB_34884| Best HMM Match : RVT_1 (HMM E-Value=8.1e-25) Length = 439 Score = 31.9 bits (69), Expect = 0.62 Identities = 15/39 (38%), Positives = 23/39 (58%) Frame = -2 Query: 647 LLYKTCIRPVMTYASVVFAHAARTHLKSLQVIQSRFCRI 531 +LY T + P +TY+ V + + T LK L ++Q R RI Sbjct: 281 MLYYTLLFPFLTYSVVTWGNTYATTLKPLFILQKRAIRI 319 >SB_10379| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 265 Score = 31.5 bits (68), Expect = 0.82 Identities = 11/47 (23%), Positives = 27/47 (57%) Frame = -2 Query: 674 ANCPSAIR*LLYKTCIRPVMTYASVVFAHAARTHLKSLQVIQSRFCR 534 ++CP A++ YK +RP++ Y + ++ + ++ ++ +Q R R Sbjct: 157 SSCPVAVKEQAYKALVRPLVEYGTEAWSPHTKKDIQKVESVQRRAAR 203 >SB_25515| Best HMM Match : Complex1_LYR (HMM E-Value=9.6) Length = 304 Score = 31.5 bits (68), Expect = 0.82 Identities = 10/44 (22%), Positives = 27/44 (61%) Frame = -2 Query: 674 ANCPSAIR*LLYKTCIRPVMTYASVVFAHAARTHLKSLQVIQSR 543 ++CP+A++ YK +RP++ Y + ++ + ++ ++ +Q R Sbjct: 138 SSCPAAVKEQAYKALVRPLVEYGTEAWSPHTKKDIQKVESVQRR 181 >SB_4872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 403 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/38 (36%), Positives = 24/38 (63%), Gaps = 1/38 (2%) Frame = -2 Query: 641 YKTCIRPVMTYASVVFAHAARTHL-KSLQVIQSRFCRI 531 ++TC+RP+ YA V+ + ++L SL+ +Q R RI Sbjct: 289 FRTCVRPITEYACPVYHDSLPSYLSNSLEQVQRRALRI 326 >SB_33068| Best HMM Match : Galactosyl_T (HMM E-Value=5.9e-37) Length = 646 Score = 31.1 bits (67), Expect = 1.1 Identities = 23/74 (31%), Positives = 36/74 (48%) Frame = -1 Query: 405 PSHRSRWKLHTRPSRPNGKPSTSPKARHYGSS*SINGAFRHHKHRSPSSSNPSLATKGST 226 P+ R L T+P RPN P+ + + +S S GA ++K S S+ P L + S+ Sbjct: 75 PTTNVRLTLLTQPPRPNQDPN---RKTNRAASGSWCGARTYNKRASTLSTQPRL-YQDSS 130 Query: 225 SELTHRHSPLSFSP 184 E T +H + P Sbjct: 131 KEQTEQHQRVGAEP 144 >SB_49429| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 918 Score = 30.7 bits (66), Expect = 1.4 Identities = 15/49 (30%), Positives = 23/49 (46%) Frame = -2 Query: 668 CPSAIR*LLYKTCIRPVMTYASVVFAHAARTHLKSLQVIQSRFCRIAVG 522 C +++ Y + IRPVM YAS V+ + L+ +Q R G Sbjct: 750 CSQSVKERAYFSMIRPVMEYASPVWNPFTDRDINKLEQVQKNAARFVTG 798 >SB_43617| Best HMM Match : RVT_1 (HMM E-Value=3e-21) Length = 314 Score = 30.7 bits (66), Expect = 1.4 Identities = 15/49 (30%), Positives = 23/49 (46%) Frame = -2 Query: 668 CPSAIR*LLYKTCIRPVMTYASVVFAHAARTHLKSLQVIQSRFCRIAVG 522 C +++ Y + IRPVM YAS V+ + L+ +Q R G Sbjct: 254 CSQSVKERAYFSMIRPVMEYASPVWNPFTDRDINKLEQVQKNAARFVTG 302 >SB_43127| Best HMM Match : DUF1690 (HMM E-Value=2.2) Length = 449 Score = 30.7 bits (66), Expect = 1.4 Identities = 15/49 (30%), Positives = 23/49 (46%) Frame = -2 Query: 668 CPSAIR*LLYKTCIRPVMTYASVVFAHAARTHLKSLQVIQSRFCRIAVG 522 C +++ Y + IRPVM YAS V+ + L+ +Q R G Sbjct: 154 CSQSVKERAYFSMIRPVMEYASPVWNPFTDRDINKLEQVQKNAARFVTG 202 >SB_34112| Best HMM Match : RVT_1 (HMM E-Value=0.041) Length = 858 Score = 30.7 bits (66), Expect = 1.4 Identities = 15/46 (32%), Positives = 25/46 (54%) Frame = -2 Query: 653 R*LLYKTCIRPVMTYASVVFAHAARTHLKSLQVIQSRFCRIAVGAP 516 R LLY T +RP + YAS +++ + H ++ IQ R + + P Sbjct: 725 RQLLYCTLVRPHLEYASCIWSPSTGKHKALIENIQCRASKFILNYP 770 >SB_32197| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 30.7 bits (66), Expect = 1.4 Identities = 12/47 (25%), Positives = 26/47 (55%) Frame = -2 Query: 674 ANCPSAIR*LLYKTCIRPVMTYASVVFAHAARTHLKSLQVIQSRFCR 534 + C ++ Y+T +RP + YA+ + + ++K +++IQ R R Sbjct: 566 SGCSPEVKDSAYRTLVRPKLEYATSAWNPYTQCNIKKIEMIQRRAAR 612 >SB_31373| Best HMM Match : Put_DNA-bind_N (HMM E-Value=8.4) Length = 198 Score = 30.7 bits (66), Expect = 1.4 Identities = 15/49 (30%), Positives = 23/49 (46%) Frame = -2 Query: 668 CPSAIR*LLYKTCIRPVMTYASVVFAHAARTHLKSLQVIQSRFCRIAVG 522 C +++ Y + IRPVM YAS V+ + L+ +Q R G Sbjct: 30 CSQSVKERAYFSMIRPVMEYASPVWNPFTDRDINKLEQVQKNAARFVTG 78 >SB_31120| Best HMM Match : Pox_F16 (HMM E-Value=5) Length = 284 Score = 30.7 bits (66), Expect = 1.4 Identities = 15/49 (30%), Positives = 23/49 (46%) Frame = -2 Query: 668 CPSAIR*LLYKTCIRPVMTYASVVFAHAARTHLKSLQVIQSRFCRIAVG 522 C +++ Y + IRPVM YAS V+ + L+ +Q R G Sbjct: 116 CSQSVKERAYFSMIRPVMEYASPVWNPFTDRDINKLEQVQKNAARFVTG 164 >SB_30875| Best HMM Match : Rubredoxin (HMM E-Value=1.6) Length = 1130 Score = 30.7 bits (66), Expect = 1.4 Identities = 15/39 (38%), Positives = 22/39 (56%), Gaps = 1/39 (2%) Frame = -2 Query: 641 YKTCIRPVMTYASVVFAHAARTHLK-SLQVIQSRFCRIA 528 Y TC+RP++ Y + + HA +LK L+ IQ IA Sbjct: 292 YDTCVRPILEYCAPLSYHAIPAYLKEDLEHIQKSALSIA 330 >SB_25871| Best HMM Match : SLH (HMM E-Value=1.1) Length = 172 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/35 (40%), Positives = 22/35 (62%) Frame = -2 Query: 647 LLYKTCIRPVMTYASVVFAHAARTHLKSLQVIQSR 543 ++Y++ +R + YASVVFA R SL+ +Q R Sbjct: 26 VVYRSLVRSTLEYASVVFADLPRYLSDSLERVQKR 60 >SB_15881| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 796 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/38 (36%), Positives = 24/38 (63%), Gaps = 1/38 (2%) Frame = -2 Query: 641 YKTCIRPVMTYASVVFAHAARTHL-KSLQVIQSRFCRI 531 ++TC+RP+ YA V+ + ++L SL+ +Q R RI Sbjct: 683 FRTCVRPITEYACPVYHDSLPSYLSNSLEQVQRRGLRI 720 >SB_6495| Best HMM Match : RVT_1 (HMM E-Value=1.2e-17) Length = 554 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/35 (40%), Positives = 22/35 (62%) Frame = -2 Query: 647 LLYKTCIRPVMTYASVVFAHAARTHLKSLQVIQSR 543 ++Y++ +R + YASVVFA R SL+ +Q R Sbjct: 408 VVYRSLVRSTLEYASVVFADLPRYLSDSLERVQKR 442 >SB_4935| Best HMM Match : Pox_F16 (HMM E-Value=5.3) Length = 243 Score = 30.7 bits (66), Expect = 1.4 Identities = 15/49 (30%), Positives = 23/49 (46%) Frame = -2 Query: 668 CPSAIR*LLYKTCIRPVMTYASVVFAHAARTHLKSLQVIQSRFCRIAVG 522 C +++ Y + IRPVM YAS V+ + L+ +Q R G Sbjct: 75 CSQSVKERAYFSMIRPVMEYASPVWNPFTDRDINKLEQVQKNAARFVTG 123 >SB_4770| Best HMM Match : Exo_endo_phos (HMM E-Value=0.031) Length = 599 Score = 30.7 bits (66), Expect = 1.4 Identities = 16/44 (36%), Positives = 26/44 (59%) Frame = -2 Query: 647 LLYKTCIRPVMTYASVVFAHAARTHLKSLQVIQSRFCRIAVGAP 516 ++Y++ +R + YASVVFA R SL+ +Q C +A+ P Sbjct: 474 VVYRSLVRSTLEYASVVFADLPRYLSDSLERVQK--CTLAIIYP 515 >SB_56531| Best HMM Match : SLH (HMM E-Value=1.1) Length = 151 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/35 (40%), Positives = 22/35 (62%) Frame = -2 Query: 647 LLYKTCIRPVMTYASVVFAHAARTHLKSLQVIQSR 543 ++Y++ +R + YASVVFA R SL+ +Q R Sbjct: 26 VVYRSLVRSTLKYASVVFADLPRYLSDSLERVQKR 60 >SB_54752| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 792 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/46 (30%), Positives = 25/46 (54%) Frame = -2 Query: 653 R*LLYKTCIRPVMTYASVVFAHAARTHLKSLQVIQSRFCRIAVGAP 516 R LLY T +RP + YAS +++ + H ++ +Q R + + P Sbjct: 628 RQLLYCTLVRPSLEYASCIWSPSTGKHKALIENVQRRASKFILNYP 673 >SB_52464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2529 Score = 30.7 bits (66), Expect = 1.4 Identities = 15/49 (30%), Positives = 23/49 (46%) Frame = -2 Query: 668 CPSAIR*LLYKTCIRPVMTYASVVFAHAARTHLKSLQVIQSRFCRIAVG 522 C +++ Y + IRPVM YAS V+ + L+ +Q R G Sbjct: 1457 CSQSVKERAYFSMIRPVMEYASPVWNPFTDRDINKLEQVQKNAARFVTG 1505 >SB_51257| Best HMM Match : Pox_F16 (HMM E-Value=4.1) Length = 243 Score = 30.7 bits (66), Expect = 1.4 Identities = 15/49 (30%), Positives = 23/49 (46%) Frame = -2 Query: 668 CPSAIR*LLYKTCIRPVMTYASVVFAHAARTHLKSLQVIQSRFCRIAVG 522 C +++ Y + IRPVM YAS V+ + L+ +Q R G Sbjct: 75 CSQSVKERAYFSMIRPVMEYASPVWNPFTDRDINKLEQVQKNAARFVTG 123 >SB_43623| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 475 Score = 30.7 bits (66), Expect = 1.4 Identities = 13/38 (34%), Positives = 22/38 (57%) Frame = -2 Query: 644 LYKTCIRPVMTYASVVFAHAARTHLKSLQVIQSRFCRI 531 +Y I+P Y S V+ + H++ LQV+Q+R R+ Sbjct: 224 IYNALIKPHFGYCSEVWDTLGQGHVRRLQVLQNRAARV 261 >SB_30407| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 788 Score = 30.7 bits (66), Expect = 1.4 Identities = 15/49 (30%), Positives = 23/49 (46%) Frame = -2 Query: 668 CPSAIR*LLYKTCIRPVMTYASVVFAHAARTHLKSLQVIQSRFCRIAVG 522 C +++ Y + IRPVM YAS V+ + L+ +Q R G Sbjct: 441 CSQSVKERAYFSMIRPVMEYASPVWNPFTDRDINKLEQVQKNAARFVTG 489 >SB_28762| Best HMM Match : RVT_1 (HMM E-Value=3.9e-23) Length = 409 Score = 30.7 bits (66), Expect = 1.4 Identities = 15/49 (30%), Positives = 23/49 (46%) Frame = -2 Query: 668 CPSAIR*LLYKTCIRPVMTYASVVFAHAARTHLKSLQVIQSRFCRIAVG 522 C +++ Y + IRPVM YAS V+ + L+ +Q R G Sbjct: 254 CSQSVKERAYFSMIRPVMEYASPVWNPFTDRDINKLEQVQKNAARFVTG 302 >SB_20783| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 295 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/46 (30%), Positives = 25/46 (54%) Frame = -2 Query: 653 R*LLYKTCIRPVMTYASVVFAHAARTHLKSLQVIQSRFCRIAVGAP 516 R LLY T +RP + YAS +++ + H ++ +Q R + + P Sbjct: 131 RQLLYCTLVRPSLEYASCIWSPSTGKHKALIENVQRRASKFILNYP 176 >SB_18046| Best HMM Match : RVT_1 (HMM E-Value=0.34) Length = 837 Score = 30.7 bits (66), Expect = 1.4 Identities = 15/49 (30%), Positives = 23/49 (46%) Frame = -2 Query: 668 CPSAIR*LLYKTCIRPVMTYASVVFAHAARTHLKSLQVIQSRFCRIAVG 522 C +++ Y + IRPVM YAS V+ + L+ +Q R G Sbjct: 669 CSQSVKERAYFSMIRPVMEYASPVWNPFTDRDINKLEQVQKNAARFVTG 717 >SB_16492| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 295 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/46 (30%), Positives = 25/46 (54%) Frame = -2 Query: 653 R*LLYKTCIRPVMTYASVVFAHAARTHLKSLQVIQSRFCRIAVGAP 516 R LLY T +RP + YAS +++ + H ++ +Q R + + P Sbjct: 131 RQLLYCTLVRPHLEYASCIWSPSTGKHKALIENVQRRASKFVLNYP 176 >SB_11572| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 888 Score = 30.7 bits (66), Expect = 1.4 Identities = 15/49 (30%), Positives = 23/49 (46%) Frame = -2 Query: 668 CPSAIR*LLYKTCIRPVMTYASVVFAHAARTHLKSLQVIQSRFCRIAVG 522 C +++ Y + IRPVM YAS V+ + L+ +Q R G Sbjct: 431 CSQSVKERAYFSMIRPVMEYASPVWNPFTDRDINKLEQVQKNAARFVTG 479 >SB_11516| Best HMM Match : Lectin_C (HMM E-Value=2.9) Length = 267 Score = 30.7 bits (66), Expect = 1.4 Identities = 12/47 (25%), Positives = 26/47 (55%) Frame = -2 Query: 674 ANCPSAIR*LLYKTCIRPVMTYASVVFAHAARTHLKSLQVIQSRFCR 534 + C ++ Y+T +RP + YA+ + + ++K +++IQ R R Sbjct: 194 SGCSPEVKDSAYRTLVRPKLEYATSAWNPYTQCNIKKIEMIQRRAAR 240 >SB_9954| Best HMM Match : SLH (HMM E-Value=1.1) Length = 132 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/35 (40%), Positives = 22/35 (62%) Frame = -2 Query: 647 LLYKTCIRPVMTYASVVFAHAARTHLKSLQVIQSR 543 ++Y++ +R + YASVVFA R SL+ +Q R Sbjct: 7 VVYRSLVRSTLEYASVVFADLPRYLSDSLERVQKR 41 >SB_8726| Best HMM Match : Pox_F16 (HMM E-Value=5.2) Length = 244 Score = 30.7 bits (66), Expect = 1.4 Identities = 15/49 (30%), Positives = 23/49 (46%) Frame = -2 Query: 668 CPSAIR*LLYKTCIRPVMTYASVVFAHAARTHLKSLQVIQSRFCRIAVG 522 C +++ Y + IRPVM YAS V+ + L+ +Q R G Sbjct: 136 CSQSVKERAYFSMIRPVMEYASPVWNPFTDRDINKLEQVQKNAARFVTG 184 >SB_58764| Best HMM Match : Sex_peptide (HMM E-Value=5.7) Length = 418 Score = 30.3 bits (65), Expect = 1.9 Identities = 12/41 (29%), Positives = 23/41 (56%) Frame = -2 Query: 674 ANCPSAIR*LLYKTCIRPVMTYASVVFAHAARTHLKSLQVI 552 +NCP I+ YK+ + P + YAS + + H+K ++ + Sbjct: 161 SNCPENIKEAAYKSLVLPHLEYASSAWDPWLKKHVKQIEKV 201 >SB_56417| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 342 Score = 30.3 bits (65), Expect = 1.9 Identities = 14/46 (30%), Positives = 25/46 (54%) Frame = -2 Query: 653 R*LLYKTCIRPVMTYASVVFAHAARTHLKSLQVIQSRFCRIAVGAP 516 R LLY T +RP + YAS +++ + H ++ +Q R + + P Sbjct: 83 RQLLYCTLVRPHLEYASCIWSPSTGKHKALIENVQRRASKFILNYP 128 >SB_44720| Best HMM Match : Helicase_C (HMM E-Value=0.59) Length = 625 Score = 30.3 bits (65), Expect = 1.9 Identities = 20/53 (37%), Positives = 26/53 (49%) Frame = -1 Query: 381 LHTRPSRPNGKPSTSPKARHYGSS*SINGAFRHHKHRSPSSSNPSLATKGSTS 223 L P RP G S K+ GS S + KH SPS S+ + TKG+T+ Sbjct: 472 LSAPPPRPQGNLLESLKSSE-GSMESTSNDSPLRKHSSPSLSDAIMRTKGTTN 523 >SB_41825| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 825 Score = 30.3 bits (65), Expect = 1.9 Identities = 26/80 (32%), Positives = 35/80 (43%), Gaps = 1/80 (1%) Frame = -1 Query: 402 SHRSRWKLHTRPSRPNGKPSTSPKARHYGSS*SINGAFRHHKHRSPSSSNP-SLATKGST 226 SHR R KL RP + +G +T+ K H I S +P S AT ++ Sbjct: 593 SHRRRHKLRARPFQADGTDTTNSKLTHRDELSYIPLKSSSSGSTQTSRDSPRSTATFLAS 652 Query: 225 SELTHRHSPLSFSPDLLSGS 166 S+ P+S S D SGS Sbjct: 653 SDSHGAAFPVSASIDTHSGS 672 >SB_35765| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 30.3 bits (65), Expect = 1.9 Identities = 15/39 (38%), Positives = 24/39 (61%) Frame = -2 Query: 644 LYKTCIRPVMTYASVVFAHAARTHLKSLQVIQSRFCRIA 528 +Y++ IR V+ YAS VFA+ +L+ +Q R +IA Sbjct: 64 VYRSLIRSVIEYASAVFANLPNYLSDALENVQRRALKIA 102 >SB_32837| Best HMM Match : RVT_1 (HMM E-Value=8.3e-17) Length = 327 Score = 30.3 bits (65), Expect = 1.9 Identities = 13/47 (27%), Positives = 26/47 (55%) Frame = -2 Query: 674 ANCPSAIR*LLYKTCIRPVMTYASVVFAHAARTHLKSLQVIQSRFCR 534 ++CP+ ++ Y + +RPV YAS ++ + + ++ IQ R R Sbjct: 252 SSCPAEVKEKAYISLVRPVAEYASPAWSPHTQKDINCVESIQRRAAR 298 >SB_27763| Best HMM Match : VapD_N (HMM E-Value=10) Length = 243 Score = 30.3 bits (65), Expect = 1.9 Identities = 13/47 (27%), Positives = 26/47 (55%) Frame = -2 Query: 674 ANCPSAIR*LLYKTCIRPVMTYASVVFAHAARTHLKSLQVIQSRFCR 534 ++CP+ ++ Y + +RPV YAS ++ + + ++ IQ R R Sbjct: 168 SSCPAEVKEKAYISLVRPVAEYASPAWSPHTQKDINCVESIQRRAAR 214 >SB_59287| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 30.3 bits (65), Expect = 1.9 Identities = 15/39 (38%), Positives = 24/39 (61%) Frame = -2 Query: 644 LYKTCIRPVMTYASVVFAHAARTHLKSLQVIQSRFCRIA 528 +Y++ IR V+ YAS VFA+ +L+ +Q R +IA Sbjct: 64 VYRSLIRSVIEYASAVFANLPNYLSDALENVQRRALKIA 102 >SB_42738| Best HMM Match : 7tm_1 (HMM E-Value=0.89) Length = 1354 Score = 30.3 bits (65), Expect = 1.9 Identities = 14/46 (30%), Positives = 25/46 (54%) Frame = -2 Query: 653 R*LLYKTCIRPVMTYASVVFAHAARTHLKSLQVIQSRFCRIAVGAP 516 R LLY T +RP + YAS +++ + H ++ +Q R + + P Sbjct: 876 RQLLYCTLVRPHLEYASCIWSPSTGKHKALIENVQRRASKFILNYP 921 >SB_39804| Best HMM Match : VapD_N (HMM E-Value=10) Length = 194 Score = 30.3 bits (65), Expect = 1.9 Identities = 13/47 (27%), Positives = 26/47 (55%) Frame = -2 Query: 674 ANCPSAIR*LLYKTCIRPVMTYASVVFAHAARTHLKSLQVIQSRFCR 534 ++CP+ ++ Y + +RPV YAS ++ + + ++ IQ R R Sbjct: 119 SSCPAEVKEKAYISLVRPVAEYASPAWSPHTQKDINCVESIQRRAAR 165 >SB_30760| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1868 Score = 30.3 bits (65), Expect = 1.9 Identities = 14/46 (30%), Positives = 25/46 (54%) Frame = -2 Query: 653 R*LLYKTCIRPVMTYASVVFAHAARTHLKSLQVIQSRFCRIAVGAP 516 R LLY T +RP + YAS +++ + H ++ +Q R + + P Sbjct: 1769 RQLLYCTLVRPHLEYASCIWSPSTGKHKALIENVQRRASKFILNYP 1814 >SB_4883| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 721 Score = 30.3 bits (65), Expect = 1.9 Identities = 14/46 (30%), Positives = 25/46 (54%) Frame = -2 Query: 653 R*LLYKTCIRPVMTYASVVFAHAARTHLKSLQVIQSRFCRIAVGAP 516 R LLY T +RP + YAS +++ + H ++ +Q R + + P Sbjct: 552 RQLLYCTLVRPHLEYASCIWSPSTGKHKALIENVQRRASKFILNYP 597 >SB_207| Best HMM Match : RVT_1 (HMM E-Value=7.4e-06) Length = 773 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/40 (40%), Positives = 22/40 (55%), Gaps = 1/40 (2%) Frame = -2 Query: 647 LLYKTCIRPVMTYASVVFAHAARTHLKS-LQVIQSRFCRI 531 L Y TCIRP YA +F ++ +L + L+ Q R RI Sbjct: 687 LFYLTCIRPCTEYACALFHNSLTKYLAADLESCQKRVLRI 726 >SB_54561| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 217 Score = 29.9 bits (64), Expect = 2.5 Identities = 14/46 (30%), Positives = 25/46 (54%) Frame = -2 Query: 653 R*LLYKTCIRPVMTYASVVFAHAARTHLKSLQVIQSRFCRIAVGAP 516 R LLY T +RP + YAS +++ + H ++ +Q R + + P Sbjct: 136 RQLLYCTFVRPHLEYASCIWSPSTGKHKALIENVQRRASKFILNYP 181 >SB_28982| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1287 Score = 29.9 bits (64), Expect = 2.5 Identities = 16/40 (40%), Positives = 22/40 (55%), Gaps = 1/40 (2%) Frame = -2 Query: 647 LLYKTCIRPVMTYASVVFAHAARTHLKS-LQVIQSRFCRI 531 L Y TCIRP YA +F ++ +L + L+ Q R RI Sbjct: 680 LFYLTCIRPCTEYACALFHNSLTKYLAADLESCQKRALRI 719 >SB_19117| Best HMM Match : XPG_N (HMM E-Value=1.8) Length = 361 Score = 29.9 bits (64), Expect = 2.5 Identities = 14/48 (29%), Positives = 25/48 (52%), Gaps = 3/48 (6%) Frame = -2 Query: 671 NCPSAIR*LLYKTCIRPVMTYASVVFAHAARTHLKSLQVIQ---SRFC 537 NC ++ Y +RP++ YAS + + + SL+ +Q +RFC Sbjct: 197 NCHQRVKVTAYTAIVRPMLEYASAAWDPHLQKDIASLEKVQRKAARFC 244 >SB_43973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3142 Score = 29.9 bits (64), Expect = 2.5 Identities = 30/83 (36%), Positives = 40/83 (48%), Gaps = 8/83 (9%) Frame = -1 Query: 408 EPSHRS-RWK-LH----TRPSRPNGKPSTSPKARHYGSS*SINGAFRHHKHRSPS--SSN 253 +P+ RS RWK LH + S N P TSP + S N A H SPS SS Sbjct: 2792 KPTARSIRWKELHCNTSSSSSSQNTSPGTSPYTSSHQIGRSPNHALPHPSTGSPSQPSSR 2851 Query: 252 PSLATKGSTSELTHRHSPLSFSP 184 PS ++ +++ + HS S SP Sbjct: 2852 PSRSSSFYSAQGSF-HSFTSLSP 2873 >SB_41541| Best HMM Match : RVT_1 (HMM E-Value=3.1e-17) Length = 283 Score = 29.9 bits (64), Expect = 2.5 Identities = 12/39 (30%), Positives = 22/39 (56%) Frame = -2 Query: 674 ANCPSAIR*LLYKTCIRPVMTYASVVFAHAARTHLKSLQ 558 +NCP I+ YK+ + P + YAS + + H+K ++ Sbjct: 244 SNCPENIKEAAYKSLVLPHLEYASSAWDPWLKKHVKQIE 282 >SB_35242| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 229 Score = 29.9 bits (64), Expect = 2.5 Identities = 11/48 (22%), Positives = 26/48 (54%) Frame = -2 Query: 674 ANCPSAIR*LLYKTCIRPVMTYASVVFAHAARTHLKSLQVIQSRFCRI 531 + C ++ Y+T +RP + YA++ + + ++ +++IQ R I Sbjct: 168 SGCSPEVKDSAYRTLVRPKLEYATIAWNPYTQCNINKIEMIQRRAASI 215 >SB_50942| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 638 Score = 29.5 bits (63), Expect = 3.3 Identities = 13/38 (34%), Positives = 25/38 (65%) Frame = -2 Query: 644 LYKTCIRPVMTYASVVFAHAARTHLKSLQVIQSRFCRI 531 +Y + IR ++ YA+VVF++ + ++L+ +Q R RI Sbjct: 134 VYCSLIRSILEYATVVFSNLPKYLSEALEKVQKRSLRI 171 >SB_7179| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 29.5 bits (63), Expect = 3.3 Identities = 14/35 (40%), Positives = 21/35 (60%) Frame = -2 Query: 647 LLYKTCIRPVMTYASVVFAHAARTHLKSLQVIQSR 543 ++Y++ +R + YASVVFA R SL +Q R Sbjct: 26 VVYRSLVRSTLEYASVVFADLPRYPSDSLVRVQKR 60 >SB_53893| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 764 Score = 29.1 bits (62), Expect = 4.4 Identities = 14/35 (40%), Positives = 21/35 (60%) Frame = -2 Query: 647 LLYKTCIRPVMTYASVVFAHAARTHLKSLQVIQSR 543 ++Y++ +R + YASVVFA R SL +Q R Sbjct: 634 VVYRSLVRSTLEYASVVFADLPRYLSDSLVRVQKR 668 >SB_39569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 857 Score = 29.1 bits (62), Expect = 4.4 Identities = 14/30 (46%), Positives = 18/30 (60%) Frame = -2 Query: 653 R*LLYKTCIRPVMTYASVVFAHAARTHLKS 564 R L YK CIR + YA VF +A +LK+ Sbjct: 647 RTLFYKACIRSAVDYAVPVFHNALPQYLKN 676 >SB_31184| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 724 Score = 29.1 bits (62), Expect = 4.4 Identities = 15/37 (40%), Positives = 20/37 (54%) Frame = -2 Query: 674 ANCPSAIR*LLYKTCIRPVMTYASVVFAHAARTHLKS 564 A P + L YK CIR + YA VF +A +LK+ Sbjct: 592 ARLPPSDLSLFYKACIRSAVDYAVPVFHNALPQYLKN 628 >SB_7051| Best HMM Match : RVT_1 (HMM E-Value=0.064) Length = 756 Score = 29.1 bits (62), Expect = 4.4 Identities = 14/35 (40%), Positives = 21/35 (60%) Frame = -2 Query: 647 LLYKTCIRPVMTYASVVFAHAARTHLKSLQVIQSR 543 ++Y++ +R + YASVVFA R SL +Q R Sbjct: 150 VVYRSLVRSTLEYASVVFADLPRYLSDSLVRVQKR 184 >SB_53402| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 29.1 bits (62), Expect = 4.4 Identities = 16/45 (35%), Positives = 23/45 (51%), Gaps = 5/45 (11%) Frame = +3 Query: 321 NDVLWATSTVYHSVYWVG-----YVISSGYDERVLMSCRLLKMAQ 440 NDVL +YH VYW G ++S ++E V SC K+ + Sbjct: 22 NDVLAQRLLIYHPVYWGGRTSLSLAVASRHEEFVAHSCCQKKLTE 66 >SB_32094| Best HMM Match : RVT_1 (HMM E-Value=1.9e-12) Length = 642 Score = 29.1 bits (62), Expect = 4.4 Identities = 15/37 (40%), Positives = 20/37 (54%) Frame = -2 Query: 674 ANCPSAIR*LLYKTCIRPVMTYASVVFAHAARTHLKS 564 A P + L YK CIR + YA VF +A +LK+ Sbjct: 510 ARLPPSDLSLFYKACIRSAVDYAVPVFHNALPQYLKN 546 >SB_15386| Best HMM Match : CSE2 (HMM E-Value=0.18) Length = 379 Score = 29.1 bits (62), Expect = 4.4 Identities = 15/37 (40%), Positives = 20/37 (54%) Frame = -2 Query: 674 ANCPSAIR*LLYKTCIRPVMTYASVVFAHAARTHLKS 564 A P + L YK CIR + YA VF +A +LK+ Sbjct: 247 ARLPPSDLSLFYKACIRSAVDYAVPVFHNALPQYLKN 283 >SB_45989| Best HMM Match : TFIIE_alpha (HMM E-Value=5) Length = 194 Score = 28.7 bits (61), Expect = 5.8 Identities = 15/37 (40%), Positives = 20/37 (54%) Frame = -2 Query: 674 ANCPSAIR*LLYKTCIRPVMTYASVVFAHAARTHLKS 564 A P + L YK CIR + YA VF +A +LK+ Sbjct: 61 ARLPPSDLSLFYKPCIRSAVDYAVPVFHNALPQYLKN 97 >SB_42093| Best HMM Match : RVT_1 (HMM E-Value=2.5e-20) Length = 325 Score = 28.7 bits (61), Expect = 5.8 Identities = 11/47 (23%), Positives = 25/47 (53%) Frame = -2 Query: 674 ANCPSAIR*LLYKTCIRPVMTYASVVFAHAARTHLKSLQVIQSRFCR 534 + C ++ Y+T +RP + YA+ + + ++ +++IQ R R Sbjct: 252 SGCSPEVKDSAYRTLVRPKLEYATSAWNPYTQCNINKIEMIQRRAAR 298 >SB_40417| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 681 Score = 28.7 bits (61), Expect = 5.8 Identities = 11/47 (23%), Positives = 25/47 (53%) Frame = -2 Query: 674 ANCPSAIR*LLYKTCIRPVMTYASVVFAHAARTHLKSLQVIQSRFCR 534 + C ++ Y+T +RP + YA+ + + ++ +++IQ R R Sbjct: 252 SGCSPEVKDSAYRTLVRPKLEYATSAWNPYTQCNINKIEMIQRRAAR 298 >SB_38350| Best HMM Match : OCIA (HMM E-Value=6.7) Length = 537 Score = 28.7 bits (61), Expect = 5.8 Identities = 11/47 (23%), Positives = 25/47 (53%) Frame = -2 Query: 674 ANCPSAIR*LLYKTCIRPVMTYASVVFAHAARTHLKSLQVIQSRFCR 534 + C ++ Y+T +RP + YA+ + + ++ +++IQ R R Sbjct: 216 SGCSPEVKDSAYRTLVRPKLEYATSAWNPYTQCNINKIEMIQRRAAR 262 >SB_36411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 654 Score = 28.7 bits (61), Expect = 5.8 Identities = 16/35 (45%), Positives = 19/35 (54%), Gaps = 1/35 (2%) Frame = -1 Query: 285 HHKHRSPSSSNPSLATKGSTSELTHRHSP-LSFSP 184 HH+H SPSS +PS + H H P LS SP Sbjct: 605 HHRH-SPSSPSPSCIAIITVIHYRHNHHPALSSSP 638 >SB_33952| Best HMM Match : Lectin_C (HMM E-Value=3.1) Length = 311 Score = 28.7 bits (61), Expect = 5.8 Identities = 11/47 (23%), Positives = 25/47 (53%) Frame = -2 Query: 674 ANCPSAIR*LLYKTCIRPVMTYASVVFAHAARTHLKSLQVIQSRFCR 534 + C ++ Y+T +RP + YA+ + + ++ +++IQ R R Sbjct: 168 SGCSPEVKDSAYRTLVRPKLEYATSAWNPYTQCNINKIEMIQRRAAR 214 >SB_28572| Best HMM Match : RVT_1 (HMM E-Value=2e-20) Length = 388 Score = 28.7 bits (61), Expect = 5.8 Identities = 11/47 (23%), Positives = 25/47 (53%) Frame = -2 Query: 674 ANCPSAIR*LLYKTCIRPVMTYASVVFAHAARTHLKSLQVIQSRFCR 534 + C ++ Y+T +RP + YA+ + + ++ +++IQ R R Sbjct: 252 SGCSPEVKDSAYRTLVRPKLEYATSAWNPYTQCNINKIEMIQRRAAR 298 >SB_27289| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 605 Score = 28.7 bits (61), Expect = 5.8 Identities = 13/34 (38%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Frame = -2 Query: 641 YKTCIRPVMTYASVVFAHAARTHLK-SLQVIQSR 543 Y + IRPV+ Y + VF HA ++L ++ +Q R Sbjct: 490 YCSAIRPVLEYCAAVFHHALPSYLSDDIERVQKR 523 >SB_25338| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1360 Score = 28.7 bits (61), Expect = 5.8 Identities = 11/47 (23%), Positives = 25/47 (53%) Frame = -2 Query: 674 ANCPSAIR*LLYKTCIRPVMTYASVVFAHAARTHLKSLQVIQSRFCR 534 + C ++ Y+T +RP + YA+ + + ++ +++IQ R R Sbjct: 808 SGCSPEVKDSAYRTLVRPKLEYATSAWNPYTQCNINKIEMIQRRAAR 854 >SB_21287| Best HMM Match : Lectin_C (HMM E-Value=3.1) Length = 179 Score = 28.7 bits (61), Expect = 5.8 Identities = 11/47 (23%), Positives = 25/47 (53%) Frame = -2 Query: 674 ANCPSAIR*LLYKTCIRPVMTYASVVFAHAARTHLKSLQVIQSRFCR 534 + C ++ Y+T +RP + YA+ + + ++ +++IQ R R Sbjct: 106 SGCSPEVKDSAYRTLVRPKLEYATSAWNPYTQCNINKIEMIQRRAAR 152 >SB_15993| Best HMM Match : RVT_1 (HMM E-Value=7.2e-12) Length = 769 Score = 28.7 bits (61), Expect = 5.8 Identities = 11/47 (23%), Positives = 25/47 (53%) Frame = -2 Query: 674 ANCPSAIR*LLYKTCIRPVMTYASVVFAHAARTHLKSLQVIQSRFCR 534 + C ++ Y+T +RP + YA+ + + ++ +++IQ R R Sbjct: 696 SGCSPEVKDSAYRTLVRPKLEYATSAWNPYTQCNINKIEMIQRRAAR 742 >SB_8874| Best HMM Match : PhaG_MnhG_YufB (HMM E-Value=2.4) Length = 252 Score = 28.7 bits (61), Expect = 5.8 Identities = 11/47 (23%), Positives = 25/47 (53%) Frame = -2 Query: 674 ANCPSAIR*LLYKTCIRPVMTYASVVFAHAARTHLKSLQVIQSRFCR 534 + C ++ Y+T +RP + YA+ + + ++ +++IQ R R Sbjct: 201 SGCSPEVKDSAYRTLVRPKLEYATSAWNPYTQCNINKIEMIQRRAAR 247 >SB_59269| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1008 Score = 28.7 bits (61), Expect = 5.8 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = -1 Query: 378 HTRPSRPNGKPSTSPKARHYGSS 310 HTRP+R G+P+T P H+ S Sbjct: 502 HTRPTRTVGRPATLPPQSHHHRS 524 >SB_50382| Best HMM Match : RVT_1 (HMM E-Value=0.026) Length = 1036 Score = 28.7 bits (61), Expect = 5.8 Identities = 11/47 (23%), Positives = 25/47 (53%) Frame = -2 Query: 674 ANCPSAIR*LLYKTCIRPVMTYASVVFAHAARTHLKSLQVIQSRFCR 534 + C ++ Y+T +RP + YA+ + + ++ +++IQ R R Sbjct: 876 SGCSPEVKDSAYRTLVRPKLEYATSAWNPYTQCNINKIEMIQRRAAR 922 >SB_24162| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 801 Score = 28.7 bits (61), Expect = 5.8 Identities = 11/47 (23%), Positives = 25/47 (53%) Frame = -2 Query: 674 ANCPSAIR*LLYKTCIRPVMTYASVVFAHAARTHLKSLQVIQSRFCR 534 + C ++ Y+T +RP + YA+ + + ++ +++IQ R R Sbjct: 666 SGCSPEVKDSAYRTLVRPKLEYATSAWNPYTQCNINKIEMIQRRAAR 712 >SB_49650| Best HMM Match : RVT_1 (HMM E-Value=1.3) Length = 379 Score = 28.3 bits (60), Expect = 7.6 Identities = 14/35 (40%), Positives = 21/35 (60%) Frame = -2 Query: 647 LLYKTCIRPVMTYASVVFAHAARTHLKSLQVIQSR 543 ++Y++ +R + YASVVFA SL+ IQ R Sbjct: 254 VVYRSLVRSTLEYASVVFADLPGYLSDSLERIQKR 288 >SB_45959| Best HMM Match : DUF1091 (HMM E-Value=3.6) Length = 360 Score = 28.3 bits (60), Expect = 7.6 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = -2 Query: 647 LLYKTCIRPVMTYASVVFAHAARTHLKS 564 L YK CIR + YA VF +A +LK+ Sbjct: 183 LFYKACIRSAVGYAVPVFHNALPQYLKN 210 >SB_36917| Best HMM Match : RinB (HMM E-Value=2.2) Length = 522 Score = 28.3 bits (60), Expect = 7.6 Identities = 17/64 (26%), Positives = 28/64 (43%) Frame = -1 Query: 369 PSRPNGKPSTSPKARHYGSS*SINGAFRHHKHRSPSSSNPSLATKGSTSELTHRHSPLSF 190 P P+G+P + + + + + HHK+ +S L T +S R SPL+ Sbjct: 92 PRPPSGRPQSRRRKKSATNELRVRRKSSHHKYTEDASRLTGLPTHRISS--YKRDSPLAL 149 Query: 189 SPDL 178 P L Sbjct: 150 QPSL 153 >SB_29434| Best HMM Match : Peptidase_A17 (HMM E-Value=3.1e-25) Length = 416 Score = 28.3 bits (60), Expect = 7.6 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = +2 Query: 413 VVPPSQNGAAMPTVDTY*ESRAPGRR 490 VV P QNG +P TY S PG R Sbjct: 16 VVSPYQNGTEIPFPQTYSRSHIPGSR 41 >SB_48151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 655 Score = 28.3 bits (60), Expect = 7.6 Identities = 15/42 (35%), Positives = 22/42 (52%) Frame = -1 Query: 696 YPMLCSRSKLSLRNKVTSXQNLHTPRHDVCKRSVRSRSPHPL 571 Y + S K+ LR KVTS + ++C+R + SR PL Sbjct: 509 YKSVSSLYKM-LREKVTSSMQSYESHFELCRREILSRLQDPL 549 >SB_45899| Best HMM Match : Exo_endo_phos (HMM E-Value=0.011) Length = 707 Score = 28.3 bits (60), Expect = 7.6 Identities = 12/34 (35%), Positives = 23/34 (67%) Frame = -2 Query: 644 LYKTCIRPVMTYASVVFAHAARTHLKSLQVIQSR 543 +Y + IR ++ YASVVF++ + ++L+ +Q R Sbjct: 641 VYCSLIRSILEYASVVFSNLPKYLSEALEKVQKR 674 >SB_41542| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 28.3 bits (60), Expect = 7.6 Identities = 9/18 (50%), Positives = 14/18 (77%) Frame = +2 Query: 179 RSGEKLSGLCLWVSSLVE 232 R+G + G+CLWV S++E Sbjct: 12 RNGSSVPGMCLWVVSIIE 29 >SB_38372| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 402 Score = 28.3 bits (60), Expect = 7.6 Identities = 11/46 (23%), Positives = 22/46 (47%) Frame = -2 Query: 668 CPSAIR*LLYKTCIRPVMTYASVVFAHAARTHLKSLQVIQSRFCRI 531 C ++ Y T +RP++ YA+ + T + L+ +Q C + Sbjct: 352 CSQLVKERAYFTLVRPILEYAAPAWNPYTDTDVNRLEQVQKNACTV 397 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,688,240 Number of Sequences: 59808 Number of extensions: 474813 Number of successful extensions: 1714 Number of sequences better than 10.0: 127 Number of HSP's better than 10.0 without gapping: 1538 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1703 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2203769656 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -