BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_T7_J09 (815 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g25605.1 68415.m03067 expressed protein 31 0.69 At4g05633.1 68417.m00876 hypothetical protein 29 2.8 At4g01030.1 68417.m00140 pentatricopeptide (PPR) repeat-containi... 29 3.7 At4g35380.1 68417.m05026 guanine nucleotide exchange family prot... 29 4.9 At4g17500.1 68417.m02618 ethylene-responsive element-binding pro... 29 4.9 At3g12690.3 68416.m01586 protein kinase, putative similar to vir... 28 8.5 At3g12690.2 68416.m01585 protein kinase, putative similar to vir... 28 8.5 At3g12690.1 68416.m01584 protein kinase, putative similar to vir... 28 8.5 >At2g25605.1 68415.m03067 expressed protein Length = 200 Score = 31.5 bits (68), Expect = 0.69 Identities = 16/41 (39%), Positives = 26/41 (63%), Gaps = 2/41 (4%) Frame = -1 Query: 446 SASMRHFDKAARHENPLIVAAGNYIPD--PADRMESSRRRP 330 SA+++HF+ R L+ A+ + +PD AD +ES R+RP Sbjct: 16 SANVKHFNGYGRLNRNLVRASSSDVPDFLSADWLESRRKRP 56 >At4g05633.1 68417.m00876 hypothetical protein Length = 376 Score = 29.5 bits (63), Expect = 2.8 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -3 Query: 744 PHIKTVTRPXRLHFRTSXPD 685 PH+ +TRP LHF T+ P+ Sbjct: 11 PHLSKITRPTYLHFSTTRPN 30 >At4g01030.1 68417.m00140 pentatricopeptide (PPR) repeat-containing protein contains INTERPRO:IPR002885 PPR repeats Length = 500 Score = 29.1 bits (62), Expect = 3.7 Identities = 13/33 (39%), Positives = 23/33 (69%), Gaps = 3/33 (9%) Frame = +2 Query: 179 SGEKLSGLCLRVNLLVEPFVAS---DGFDENGD 268 SG+++ G CLR NL+ + +VA+ D + ++GD Sbjct: 146 SGKEVHGFCLRKNLICDAYVATALVDMYGKSGD 178 >At4g35380.1 68417.m05026 guanine nucleotide exchange family protein similar to guanine nucleotide exchange factor [Homo sapiens] GI:5456754; contains Pfam profile PF01369: Sec7 domain Length = 1706 Score = 28.7 bits (61), Expect = 4.9 Identities = 20/99 (20%), Positives = 41/99 (41%) Frame = -1 Query: 659 LRNKVTLYKTCIRPVMTYASVVFAHAARIHLKSFQIIQSRFCRIAVGAPWFVRNVDLHDD 480 + ++T+Y CIR ++T+ + F I + + + RFC + + V N L ++ Sbjct: 1203 IETEITVYADCIRCLITFTNSKF--EGDIGFNTIEFL--RFCALKLEEGGLVLNEKLKNN 1258 Query: 479 LDLESISKYLQSASMRHFDKAARHENPLIVAAGNYIPDP 363 + + S D+ + PL+ + DP Sbjct: 1259 TISALKEDFSDTQSFTDLDEQVSYWIPLLTGLCKQVSDP 1297 >At4g17500.1 68417.m02618 ethylene-responsive element-binding protein 1 (ERF1) / EREBP-2 protein identical to SP|O80337 Ethylene responsive element binding factor 1 (EREBP-2 protein) [Arabidopsis thaliana]; a false single bp exon was added to circumvent a single basepair insertion in the genomic sequence, supported by cDNA/genome alignment. Length = 188 Score = 28.7 bits (61), Expect = 4.9 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +3 Query: 384 GGHDERVLVSCRFIEVAHGRRLKIL 458 GG D+ + V C +EVA G RL +L Sbjct: 164 GGMDKGLTVKCEVVEVARGDRLLVL 188 >At3g12690.3 68416.m01586 protein kinase, putative similar to viroid symptom modulation protein [Lycopersicon esculentum] gi|7672777|gb|AAF66637 Length = 577 Score = 27.9 bits (59), Expect = 8.5 Identities = 13/36 (36%), Positives = 21/36 (58%) Frame = -3 Query: 276 KHRSPFSSNPSLATKGSTSKLTLRHSPLSFSPDLLS 169 KH+ P S P +T+G+ S+ L+H+ S D L+ Sbjct: 56 KHQPPKSLEPPPSTRGTNSEGDLKHNTYSSDGDSLA 91 >At3g12690.2 68416.m01585 protein kinase, putative similar to viroid symptom modulation protein [Lycopersicon esculentum] gi|7672777|gb|AAF66637 Length = 577 Score = 27.9 bits (59), Expect = 8.5 Identities = 13/36 (36%), Positives = 21/36 (58%) Frame = -3 Query: 276 KHRSPFSSNPSLATKGSTSKLTLRHSPLSFSPDLLS 169 KH+ P S P +T+G+ S+ L+H+ S D L+ Sbjct: 56 KHQPPKSLEPPPSTRGTNSEGDLKHNTYSSDGDSLA 91 >At3g12690.1 68416.m01584 protein kinase, putative similar to viroid symptom modulation protein [Lycopersicon esculentum] gi|7672777|gb|AAF66637 Length = 577 Score = 27.9 bits (59), Expect = 8.5 Identities = 13/36 (36%), Positives = 21/36 (58%) Frame = -3 Query: 276 KHRSPFSSNPSLATKGSTSKLTLRHSPLSFSPDLLS 169 KH+ P S P +T+G+ S+ L+H+ S D L+ Sbjct: 56 KHQPPKSLEPPPSTRGTNSEGDLKHNTYSSDGDSLA 91 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,031,903 Number of Sequences: 28952 Number of extensions: 326652 Number of successful extensions: 956 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 884 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 956 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1863090400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -