BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_T7_I23 (837 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 24 1.3 U77974-1|AAB36556.1| 276|Tribolium castaneum transcription fact... 22 5.2 DQ659254-1|ABG47452.1| 431|Tribolium castaneum imaginal disc gr... 22 5.2 AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc fin... 22 5.2 S73225-1|AAB30811.1| 327|Tribolium castaneum protein ( Triboliu... 21 9.1 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 24.2 bits (50), Expect = 1.3 Identities = 15/53 (28%), Positives = 26/53 (49%), Gaps = 4/53 (7%) Frame = -2 Query: 383 PPVHRKPKSSKEHDKTPRGKSQSPG----RTRDVSVEKETVKASDKSQVDAAE 237 PP SK+++K+P + +SP T+D + E+ S S ++A E Sbjct: 681 PPESPTRDKSKQNEKSPSPQQRSPSVTDLSTKDGTTVPESNNGSSPSVLNAIE 733 >U77974-1|AAB36556.1| 276|Tribolium castaneum transcription factor homolog protein. Length = 276 Score = 22.2 bits (45), Expect = 5.2 Identities = 10/32 (31%), Positives = 16/32 (50%) Frame = -2 Query: 440 SXLHAPLRTATPAAPGEGKPPVHRKPKSSKEH 345 S +H PL T EG+ + ++PK K + Sbjct: 241 SPVHEPLLITTEKLAAEGQTKLPQQPKLFKPY 272 >DQ659254-1|ABG47452.1| 431|Tribolium castaneum imaginal disc growth factor 4 protein. Length = 431 Score = 22.2 bits (45), Expect = 5.2 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +1 Query: 337 VLSCSLDDFGFLCTG 381 ++ +LDDF LCTG Sbjct: 404 IVDITLDDFRGLCTG 418 >AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc finger protein protein. Length = 456 Score = 22.2 bits (45), Expect = 5.2 Identities = 10/30 (33%), Positives = 14/30 (46%) Frame = -2 Query: 434 LHAPLRTATPAAPGEGKPPVHRKPKSSKEH 345 LHA +P A G PP P+S + + Sbjct: 256 LHATGSAPSPTAGAGGLPPQVPSPRSQRRY 285 >S73225-1|AAB30811.1| 327|Tribolium castaneum protein ( Tribolium castaneum homeodomainprotein mRNA, complete cds. ). Length = 327 Score = 21.4 bits (43), Expect = 9.1 Identities = 15/59 (25%), Positives = 22/59 (37%) Frame = -2 Query: 371 RKPKSSKEHDKTPRGKSQSPGRTRDVSVEKETVKASDKSQVDAAEVTQKLEALQVHNGD 195 RK SS KS SPG +++ S ++ E + LQ +N D Sbjct: 64 RKSPSSPRISSPSSTKSGSPGFLTYTKADRDVDLFRGSSTPESPEHYYNQKTLQANNND 122 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 98,898 Number of Sequences: 336 Number of extensions: 1359 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 23036718 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -