BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_T7_I22 (820 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ257415-1|ABB81846.1| 430|Apis mellifera yellow-like protein p... 25 1.1 AF213012-1|AAG43568.1| 492|Apis mellifera acetylcholinesterase ... 24 1.9 AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase ... 24 1.9 AJ849455-1|CAH60991.1| 366|Apis mellifera twist protein protein. 22 5.9 >DQ257415-1|ABB81846.1| 430|Apis mellifera yellow-like protein protein. Length = 430 Score = 24.6 bits (51), Expect = 1.1 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = -3 Query: 314 SLISNLSNTCDLTPLPEWSCEQSAWWGACGRVL 216 SL +N + LTP P W+ ++ GACG + Sbjct: 98 SLDTNRGGSPKLTPYPNWAQNKA---GACGSAI 127 >AF213012-1|AAG43568.1| 492|Apis mellifera acetylcholinesterase protein. Length = 492 Score = 23.8 bits (49), Expect = 1.9 Identities = 13/43 (30%), Positives = 16/43 (37%) Frame = +2 Query: 560 STMXNTAPGRQRVCRGASPGKTFGTFATGSFHXXXXXXSAPAL 688 STM N P R C + KT S+ SAP + Sbjct: 309 STMLNENPARVMACMRSVDAKTISVQQWNSYWGILGFPSAPTI 351 >AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase protein. Length = 628 Score = 23.8 bits (49), Expect = 1.9 Identities = 13/43 (30%), Positives = 16/43 (37%) Frame = +2 Query: 560 STMXNTAPGRQRVCRGASPGKTFGTFATGSFHXXXXXXSAPAL 688 STM N P R C + KT S+ SAP + Sbjct: 309 STMLNENPARVMACMRSVDAKTISVQQWNSYWGILGFPSAPTI 351 >AJ849455-1|CAH60991.1| 366|Apis mellifera twist protein protein. Length = 366 Score = 22.2 bits (45), Expect = 5.9 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = -2 Query: 534 LAARQ*TTTSCGFSVH 487 LAAR+ T++SC + H Sbjct: 331 LAAREITSSSCSYMAH 346 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 129,792 Number of Sequences: 438 Number of extensions: 1818 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 26096055 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -