BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_T7_I15 (770 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF592178-1|ABQ95974.1| 532|Tribolium castaneum tyrosine hydroxy... 22 4.7 AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 22 6.2 >EF592178-1|ABQ95974.1| 532|Tribolium castaneum tyrosine hydroxylase protein. Length = 532 Score = 22.2 bits (45), Expect = 4.7 Identities = 8/24 (33%), Positives = 15/24 (62%) Frame = +2 Query: 425 SNSSLELGTEIFWFDVQNFRCKNS 496 S++ +E + ++WF V+ CK S Sbjct: 389 SDAEIEKLSTVYWFTVEFGLCKES 412 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.8 bits (44), Expect = 6.2 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = +3 Query: 423 LATPAWNLARRSSGLMSRISGAKIVPESYTCLTT 524 L+TP+ + A +SSGL S +S + P TT Sbjct: 129 LSTPSNSNATKSSGLTSPLSVSTSPPGKPATSTT 162 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 146,307 Number of Sequences: 336 Number of extensions: 2907 Number of successful extensions: 16 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20753800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -