BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_T7_I13 (785 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC685.06 |rps001|rps0-1, rpsa-1, rps0|40S ribosomal protein S0... 118 7e-28 SPAPJ698.02c |rps002|rpsa-2, rps0-2, rps0|40S ribosomal protein ... 114 1e-26 SPAC24C9.10c |mrp4||mitochondrial ribosomal protein subunit S2|S... 33 0.046 SPAC6G10.10c |||human hmmtag2 homolog|Schizosaccharomyces pombe|... 30 0.43 SPAC27E2.06c |||methionine-tRNA ligase, mitochondrial|Schizosacc... 28 1.3 SPCC736.06 |||aspartate-tRNA ligase|Schizosaccharomyces pombe|ch... 28 1.7 SPCC1840.08c |||protein disulfide isomerase |Schizosaccharomyces... 26 5.3 >SPBC685.06 |rps001|rps0-1, rpsa-1, rps0|40S ribosomal protein S0A |Schizosaccharomyces pombe|chr 2|||Manual Length = 292 Score = 118 bits (285), Expect = 7e-28 Identities = 56/82 (68%), Positives = 63/82 (76%) Frame = -1 Query: 602 DPAQDHQPITEASYVNIPVIALCNTDSPLRFVDIAIPCNTKSSHSIGLMWWLLAREVLRL 423 DP D Q I EAS+VNIPVIALC+TDS L VDIAIP N K SIGL+W+LLAREVLR+ Sbjct: 128 DPRADAQAIKEASFVNIPVIALCDTDSILNHVDIAIPTNNKGRKSIGLIWYLLAREVLRV 187 Query: 422 RGVLPRDQRWDVVVDLFFYRDP 357 RG L R WDV+ DL+FYRDP Sbjct: 188 RGTLSRSAPWDVMPDLYFYRDP 209 >SPAPJ698.02c |rps002|rpsa-2, rps0-2, rps0|40S ribosomal protein S0B|Schizosaccharomyces pombe|chr 1|||Manual Length = 287 Score = 114 bits (275), Expect = 1e-26 Identities = 54/82 (65%), Positives = 62/82 (75%) Frame = -1 Query: 602 DPAQDHQPITEASYVNIPVIALCNTDSPLRFVDIAIPCNTKSSHSIGLMWWLLAREVLRL 423 DP D Q I EAS+VNIPVIALC+TDS L VD+AIP N K SIGL W+LLAREVLRL Sbjct: 129 DPRADAQAIKEASFVNIPVIALCDTDSILNHVDVAIPINNKGYKSIGLAWYLLAREVLRL 188 Query: 422 RGVLPRDQRWDVVVDLFFYRDP 357 RG + R W+V+ DL+FYRDP Sbjct: 189 RGNISRTTAWEVMPDLYFYRDP 210 >SPAC24C9.10c |mrp4||mitochondrial ribosomal protein subunit S2|Schizosaccharomyces pombe|chr 1|||Manual Length = 263 Score = 33.1 bits (72), Expect = 0.046 Identities = 17/55 (30%), Positives = 27/55 (49%) Frame = -1 Query: 602 DPAQDHQPITEASYVNIPVIALCNTDSPLRFVDIAIPCNTKSSHSIGLMWWLLAR 438 +P ++ EA ++P I + +TD+ R V IP N S L+ LL+R Sbjct: 187 NPLENKSACLEAQKTHVPTIGIIDTDADPRMVTYPIPANDDSLRCTDLIAGLLSR 241 >SPAC6G10.10c |||human hmmtag2 homolog|Schizosaccharomyces pombe|chr 1|||Manual Length = 194 Score = 29.9 bits (64), Expect = 0.43 Identities = 19/43 (44%), Positives = 25/43 (58%), Gaps = 3/43 (6%) Frame = +1 Query: 352 LQGSR*KNKSTTTSQRWSRG---STPRSLSTSRANNHHIKPIE 471 L S+ N+S+T +++ SR ST RS STS AN H K E Sbjct: 99 LTSSKAANRSSTNTEKDSRSIAHSTSRSRSTSPANRHRRKEKE 141 >SPAC27E2.06c |||methionine-tRNA ligase, mitochondrial|Schizosaccharomyces pombe|chr 1|||Manual Length = 539 Score = 28.3 bits (60), Expect = 1.3 Identities = 14/37 (37%), Positives = 21/37 (56%) Frame = -1 Query: 575 TEASYVNIPVIALCNTDSPLRFVDIAIPCNTKSSHSI 465 T A + + LC+ +S RF D+A+ NTK +H I Sbjct: 75 TVAQTEGVSPLQLCDRNSK-RFADLAVAANTKFTHFI 110 >SPCC736.06 |||aspartate-tRNA ligase|Schizosaccharomyces pombe|chr 3|||Manual Length = 611 Score = 27.9 bits (59), Expect = 1.7 Identities = 14/28 (50%), Positives = 17/28 (60%) Frame = -2 Query: 421 VVCFPVTSAGMLWLICSSTVTPEESEKD 338 V+ FP TS+G LI S + PEE KD Sbjct: 571 VIAFPKTSSGADLLIGSPSAIPEEMLKD 598 >SPCC1840.08c |||protein disulfide isomerase |Schizosaccharomyces pombe|chr 3|||Manual Length = 561 Score = 26.2 bits (55), Expect = 5.3 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = -1 Query: 467 IGLMWWLLAREVLRLRGVLPRDQRWD 390 IGL W L REV R + + R++ WD Sbjct: 365 IGLKWTLKLREVERKQLLTAREKWWD 390 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,531,583 Number of Sequences: 5004 Number of extensions: 45462 Number of successful extensions: 124 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 121 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 124 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 381366860 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -