BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_T7_I12 (810 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY943929-1|AAX49502.1| 755|Anopheles gambiae laccase-2 isoform ... 25 3.7 EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calc... 24 4.8 AY943928-1|AAX49501.1| 753|Anopheles gambiae laccase-2 isoform ... 23 8.4 AY745220-1|AAU93487.1| 101|Anopheles gambiae cytochrome P450 pr... 23 8.4 AY344835-1|AAR05806.1| 334|Anopheles gambiae ICHIT protein. 23 8.4 AY344834-1|AAR05805.1| 334|Anopheles gambiae ICHIT protein. 23 8.4 AY344833-1|AAR05804.1| 334|Anopheles gambiae ICHIT protein. 23 8.4 AY344832-1|AAR05803.1| 333|Anopheles gambiae ICHIT protein. 23 8.4 AY344831-1|AAR05802.1| 333|Anopheles gambiae ICHIT protein. 23 8.4 AY344830-1|AAR05801.1| 334|Anopheles gambiae ICHIT protein. 23 8.4 AY344829-1|AAR05800.1| 334|Anopheles gambiae ICHIT protein. 23 8.4 AJ439353-4|CAD27926.1| 338|Anopheles gambiae putative hox prote... 23 8.4 AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-conta... 23 8.4 AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-sign... 23 8.4 AJ010903-1|CAA09389.1| 373|Anopheles gambiae ICHIT protein prot... 23 8.4 AF020851-1|AAC31864.1| 214|Anopheles gambiae unknown protein. 23 8.4 AF020850-1|AAC31863.1| 214|Anopheles gambiae unknown protein. 23 8.4 AF020849-1|AAC31862.1| 214|Anopheles gambiae unknown protein. 23 8.4 >AY943929-1|AAX49502.1| 755|Anopheles gambiae laccase-2 isoform B protein. Length = 755 Score = 24.6 bits (51), Expect = 3.7 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = +3 Query: 597 RGASPERHLEHCHASFHLATGPXL 668 R +P L HCH FH+ G L Sbjct: 702 RADNPGYWLFHCHFQFHIVIGMNL 725 >EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calcium channel alpha2-delta subunit 1 protein. Length = 1256 Score = 24.2 bits (50), Expect = 4.8 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +2 Query: 50 FYNITSQEHGTSIRGRGCSMDPLDC 124 F NITS+ ++ + C+ D LDC Sbjct: 930 FINITSKCTASTTCKKNCASDELDC 954 >AY943928-1|AAX49501.1| 753|Anopheles gambiae laccase-2 isoform A protein. Length = 753 Score = 23.4 bits (48), Expect = 8.4 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = +3 Query: 597 RGASPERHLEHCHASFHLATGPXL 668 R +P L HCH FH+ G L Sbjct: 702 RADNPGFWLFHCHFLFHIVIGMNL 725 >AY745220-1|AAU93487.1| 101|Anopheles gambiae cytochrome P450 protein. Length = 101 Score = 23.4 bits (48), Expect = 8.4 Identities = 12/31 (38%), Positives = 14/31 (45%) Frame = +1 Query: 61 YVPGARHFHPRSWLQYGSLRL*KDRVGAGQK 153 Y P F P WL+ G L+ AGQK Sbjct: 12 YFPEPDRFVPERWLKRGELKEHSGCPHAGQK 42 >AY344835-1|AAR05806.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 23.4 bits (48), Expect = 8.4 Identities = 11/25 (44%), Positives = 13/25 (52%), Gaps = 3/25 (12%) Frame = +1 Query: 646 TSPRVLXSAPHWTDP---SHPTLLT 711 T P + + P WTDP S PT T Sbjct: 148 TDPTITTTTPIWTDPTTWSAPTTTT 172 >AY344834-1|AAR05805.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 23.4 bits (48), Expect = 8.4 Identities = 11/25 (44%), Positives = 13/25 (52%), Gaps = 3/25 (12%) Frame = +1 Query: 646 TSPRVLXSAPHWTDP---SHPTLLT 711 T P + + P WTDP S PT T Sbjct: 148 TDPTITTTTPIWTDPTTWSAPTTTT 172 >AY344833-1|AAR05804.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 23.4 bits (48), Expect = 8.4 Identities = 11/25 (44%), Positives = 13/25 (52%), Gaps = 3/25 (12%) Frame = +1 Query: 646 TSPRVLXSAPHWTDP---SHPTLLT 711 T P + + P WTDP S PT T Sbjct: 148 TDPTITTTTPIWTDPTTWSAPTTTT 172 >AY344832-1|AAR05803.1| 333|Anopheles gambiae ICHIT protein. Length = 333 Score = 23.4 bits (48), Expect = 8.4 Identities = 11/25 (44%), Positives = 13/25 (52%), Gaps = 3/25 (12%) Frame = +1 Query: 646 TSPRVLXSAPHWTDP---SHPTLLT 711 T P + + P WTDP S PT T Sbjct: 147 TDPTITTTTPVWTDPTTWSAPTTTT 171 >AY344831-1|AAR05802.1| 333|Anopheles gambiae ICHIT protein. Length = 333 Score = 23.4 bits (48), Expect = 8.4 Identities = 11/25 (44%), Positives = 13/25 (52%), Gaps = 3/25 (12%) Frame = +1 Query: 646 TSPRVLXSAPHWTDP---SHPTLLT 711 T P + + P WTDP S PT T Sbjct: 147 TDPTITTTTPVWTDPTTWSAPTTTT 171 >AY344830-1|AAR05801.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 23.4 bits (48), Expect = 8.4 Identities = 11/25 (44%), Positives = 13/25 (52%), Gaps = 3/25 (12%) Frame = +1 Query: 646 TSPRVLXSAPHWTDP---SHPTLLT 711 T P + + P WTDP S PT T Sbjct: 148 TDPTITTTTPIWTDPTTWSAPTTTT 172 >AY344829-1|AAR05800.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 23.4 bits (48), Expect = 8.4 Identities = 11/25 (44%), Positives = 13/25 (52%), Gaps = 3/25 (12%) Frame = +1 Query: 646 TSPRVLXSAPHWTDP---SHPTLLT 711 T P + + P WTDP S PT T Sbjct: 148 TDPTITTTTPIWTDPTTWSAPTTTT 172 >AJ439353-4|CAD27926.1| 338|Anopheles gambiae putative hox protein protein. Length = 338 Score = 23.4 bits (48), Expect = 8.4 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = +3 Query: 543 EQKQEHHGEHGAGRQRVCRG 602 EQ+Q+ HG+H R C G Sbjct: 278 EQQQQQHGQHCCCRGSHCGG 297 >AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-containing phosphoprotein protein. Length = 1200 Score = 23.4 bits (48), Expect = 8.4 Identities = 12/28 (42%), Positives = 14/28 (50%) Frame = +1 Query: 262 SGSGVRSQVLERLEMRLRSGGGGARRQR 345 +GSG RS+ R R RSG R R Sbjct: 1091 AGSGSRSRSRSRSRSRSRSGSAKGSRSR 1118 >AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-signaling promoter protein. Length = 1197 Score = 23.4 bits (48), Expect = 8.4 Identities = 7/19 (36%), Positives = 14/19 (73%) Frame = +3 Query: 543 EQKQEHHGEHGAGRQRVCR 599 +Q+Q+H EH GR+++ + Sbjct: 156 QQQQQHQLEHNGGREQMMK 174 >AJ010903-1|CAA09389.1| 373|Anopheles gambiae ICHIT protein protein. Length = 373 Score = 23.4 bits (48), Expect = 8.4 Identities = 11/25 (44%), Positives = 13/25 (52%), Gaps = 3/25 (12%) Frame = +1 Query: 646 TSPRVLXSAPHWTDP---SHPTLLT 711 T P + + P WTDP S PT T Sbjct: 148 TDPTITTTTPVWTDPTTWSAPTTTT 172 >AF020851-1|AAC31864.1| 214|Anopheles gambiae unknown protein. Length = 214 Score = 23.4 bits (48), Expect = 8.4 Identities = 11/37 (29%), Positives = 16/37 (43%) Frame = -2 Query: 320 PLRSLISNLSNTCDLTPLPEWSCEQSAWWGACGRVLD 210 PL L SN ++ P P W + + CG + D Sbjct: 128 PLGILPSNQRSSSSSKPTPCWESNKDVFPKPCGNLTD 164 >AF020850-1|AAC31863.1| 214|Anopheles gambiae unknown protein. Length = 214 Score = 23.4 bits (48), Expect = 8.4 Identities = 11/37 (29%), Positives = 16/37 (43%) Frame = -2 Query: 320 PLRSLISNLSNTCDLTPLPEWSCEQSAWWGACGRVLD 210 PL L SN ++ P P W + + CG + D Sbjct: 128 PLGILPSNQRSSSSSKPTPCWESNKDVFPKPCGNLTD 164 >AF020849-1|AAC31862.1| 214|Anopheles gambiae unknown protein. Length = 214 Score = 23.4 bits (48), Expect = 8.4 Identities = 11/37 (29%), Positives = 16/37 (43%) Frame = -2 Query: 320 PLRSLISNLSNTCDLTPLPEWSCEQSAWWGACGRVLD 210 PL L SN ++ P P W + + CG + D Sbjct: 128 PLGILPSNQRSSSSSKPTPCWESNKDVFPKPCGNLTD 164 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 533,946 Number of Sequences: 2352 Number of extensions: 7718 Number of successful extensions: 32 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 31 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 32 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 85655418 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -