BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_T7_I08 (778 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292359-1|CAL23171.2| 436|Tribolium castaneum gustatory recept... 27 0.13 AM292370-1|CAL23182.1| 418|Tribolium castaneum gustatory recept... 23 3.6 AM292335-1|CAL23147.2| 374|Tribolium castaneum gustatory recept... 23 3.6 >AM292359-1|CAL23171.2| 436|Tribolium castaneum gustatory receptor candidate 38 protein. Length = 436 Score = 27.5 bits (58), Expect = 0.13 Identities = 21/71 (29%), Positives = 36/71 (50%), Gaps = 5/71 (7%) Frame = -1 Query: 697 RLYPMLCSRSKLSL--RNKVTLYKTCIRPVMTYASVVFAHAARTHLKSLQVIQSRF--CR 530 R+Y L ++ KLS+ NK + T + P++ +V H H K +QV+ + C Sbjct: 167 RIYYKL-TKKKLSVFFGNKPVIL-TVVLPLLACGVMVVTHITMAHFKIIQVVPYCYINCL 224 Query: 529 I-AVGAPWFLR 500 I +G WF++ Sbjct: 225 IYLIGGFWFMQ 235 >AM292370-1|CAL23182.1| 418|Tribolium castaneum gustatory receptor candidate 49 protein. Length = 418 Score = 22.6 bits (46), Expect = 3.6 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = +2 Query: 326 LWATSTVYHSVYWVGYVISSGY 391 L+ +T+ V W GYVI + Y Sbjct: 277 LFEITTITAMVMWFGYVIDTMY 298 >AM292335-1|CAL23147.2| 374|Tribolium castaneum gustatory receptor candidate 14 protein. Length = 374 Score = 22.6 bits (46), Expect = 3.6 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = +2 Query: 326 LWATSTVYHSVYWVGYVISSGY 391 L+ +T+ V W GYVI + Y Sbjct: 233 LFEITTITAMVMWFGYVIDTMY 254 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 166,443 Number of Sequences: 336 Number of extensions: 3363 Number of successful extensions: 7 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20961338 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -