BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_T7_H24 (813 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY094730-1|AAM11083.1| 1372|Drosophila melanogaster GH25780p pro... 30 4.3 AE014297-134|AAO41500.1| 1372|Drosophila melanogaster CG31531-PC... 30 4.3 AE014297-133|AAF52105.2| 1372|Drosophila melanogaster CG31531-PB... 30 4.3 AE014297-132|AAF52104.2| 1372|Drosophila melanogaster CG31531-PA... 30 4.3 >AY094730-1|AAM11083.1| 1372|Drosophila melanogaster GH25780p protein. Length = 1372 Score = 29.9 bits (64), Expect = 4.3 Identities = 15/49 (30%), Positives = 20/49 (40%) Frame = -3 Query: 634 LSEGPSGYFTPXSLGMGKGVSPPYFQVNDESQAXXLISCHXKNNPVPPS 488 L+ P G+ P S G SPP F +N + S P PP+ Sbjct: 764 LASSPKGHINPLSSPTNSGFSPPQFSIN--GRVEIFNSRQLDKPPTPPA 810 >AE014297-134|AAO41500.1| 1372|Drosophila melanogaster CG31531-PC, isoform C protein. Length = 1372 Score = 29.9 bits (64), Expect = 4.3 Identities = 15/49 (30%), Positives = 20/49 (40%) Frame = -3 Query: 634 LSEGPSGYFTPXSLGMGKGVSPPYFQVNDESQAXXLISCHXKNNPVPPS 488 L+ P G+ P S G SPP F +N + S P PP+ Sbjct: 764 LASSPKGHINPLSSPTNSGFSPPQFSIN--GRVEIFNSRQLDKPPTPPA 810 >AE014297-133|AAF52105.2| 1372|Drosophila melanogaster CG31531-PB, isoform B protein. Length = 1372 Score = 29.9 bits (64), Expect = 4.3 Identities = 15/49 (30%), Positives = 20/49 (40%) Frame = -3 Query: 634 LSEGPSGYFTPXSLGMGKGVSPPYFQVNDESQAXXLISCHXKNNPVPPS 488 L+ P G+ P S G SPP F +N + S P PP+ Sbjct: 764 LASSPKGHINPLSSPTNSGFSPPQFSIN--GRVEIFNSRQLDKPPTPPA 810 >AE014297-132|AAF52104.2| 1372|Drosophila melanogaster CG31531-PA, isoform A protein. Length = 1372 Score = 29.9 bits (64), Expect = 4.3 Identities = 15/49 (30%), Positives = 20/49 (40%) Frame = -3 Query: 634 LSEGPSGYFTPXSLGMGKGVSPPYFQVNDESQAXXLISCHXKNNPVPPS 488 L+ P G+ P S G SPP F +N + S P PP+ Sbjct: 764 LASSPKGHINPLSSPTNSGFSPPQFSIN--GRVEIFNSRQLDKPPTPPA 810 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,094,461 Number of Sequences: 53049 Number of extensions: 290072 Number of successful extensions: 342 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 338 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 342 length of database: 24,988,368 effective HSP length: 84 effective length of database: 20,532,252 effective search space used: 3818998872 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -