BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_T7_H17 (775 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578801-1|AAT07306.1| 506|Anopheles gambiae dSmad2 protein. 23 7.9 AF444780-1|AAL37901.1| 1152|Anopheles gambiae Toll protein. 23 7.9 >AY578801-1|AAT07306.1| 506|Anopheles gambiae dSmad2 protein. Length = 506 Score = 23.4 bits (48), Expect = 7.9 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = +2 Query: 185 QKQEPQRVQQAGRYLQPMKPLAPVFHSSLHGQ 280 Q+Q PQ+ Q + + QP+ L P S+ G+ Sbjct: 139 QQQSPQQQQSSQQLQQPLTILVPKNLSNSQGE 170 >AF444780-1|AAL37901.1| 1152|Anopheles gambiae Toll protein. Length = 1152 Score = 23.4 bits (48), Expect = 7.9 Identities = 11/28 (39%), Positives = 14/28 (50%) Frame = -2 Query: 660 GAFTNQIQAAFP*TSSLDCIGPCTRPST 577 G F Q+Q A P L+ I P P+T Sbjct: 1057 GLFMKQLQGAAPVDDRLELIKPQVTPAT 1084 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 784,608 Number of Sequences: 2352 Number of extensions: 16440 Number of successful extensions: 33 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 31 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 33 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 80665782 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -