BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_T7_H12 (785 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12670| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.065 SB_27758| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_379| Best HMM Match : ADK (HMM E-Value=3.2e-05) 34 0.15 SB_22890| Best HMM Match : 2OG-FeII_Oxy (HMM E-Value=0.00078) 32 0.61 SB_55326| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.80 SB_7913| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_1528| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_32600| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_34170| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_56440| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_54480| Best HMM Match : Folate_rec (HMM E-Value=1.5) 30 2.4 SB_56900| Best HMM Match : I-set (HMM E-Value=8e-10) 29 3.2 SB_20563| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 SB_58981| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_58632| Best HMM Match : Flp_Fap (HMM E-Value=1.1) 29 4.3 SB_26888| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_24017| Best HMM Match : DUF646 (HMM E-Value=4.1) 29 4.3 SB_8656| Best HMM Match : Chorion_3 (HMM E-Value=2.4) 29 4.3 SB_39424| Best HMM Match : Pox_A32 (HMM E-Value=0.033) 29 4.3 SB_57266| Best HMM Match : POPLD (HMM E-Value=0.55) 29 5.6 SB_46006| Best HMM Match : MAAL_N (HMM E-Value=3.7) 29 5.6 SB_33346| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_57323| Best HMM Match : ShTK (HMM E-Value=0) 29 5.6 SB_11299| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_27312| Best HMM Match : Pox_A32 (HMM E-Value=0.012) 28 7.5 SB_19217| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.5 SB_40368| Best HMM Match : SASP_gamma (HMM E-Value=2.3) 28 9.9 SB_38456| Best HMM Match : BTB (HMM E-Value=8.8e-26) 28 9.9 SB_30592| Best HMM Match : MAM (HMM E-Value=2.66247e-44) 28 9.9 >SB_12670| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1272 Score = 35.1 bits (77), Expect = 0.065 Identities = 36/143 (25%), Positives = 53/143 (37%), Gaps = 5/143 (3%) Frame = +2 Query: 122 KSRGPSPPPISHRRLRLEKGARSTCPAERLPTKPHRAPPLRLHETHGTAQCAPKARRRRY 301 + R PSPPP RR S P+ R P +PP R + +P RRRR Sbjct: 887 RRRSPSPPPRRRRR-------DSYSPSRRRRDSPTPSPPPR--RRRKSPSPSPPRRRRRS 937 Query: 302 PSC**DGTPSPGKXXXXXXXXXXXXGAQEPP-----CAASPPDQQPSTGHPRTRHPTAPT 466 PS +P P + P ASP +Q + R +P+ Sbjct: 938 PS----NSPPPMRSSPLPPPQRKRASTPPSPRRARRKVASPEEQDRQKSNGRNSRSVSPS 993 Query: 467 GDERELRARAAHSAFFAVKPKRD 535 +R ++ + S + P+RD Sbjct: 994 AVKRTKGSKRSESRSVSRSPERD 1016 Score = 29.5 bits (63), Expect = 3.2 Identities = 28/127 (22%), Positives = 35/127 (27%) Frame = +3 Query: 174 KKAREALAPQNDYRLNPIEPHHSDSTKPTVPHSARRRLAVAGTHPVNRTALHPRENPAGR 353 ++ R P R + P PT RRR P R P +P Sbjct: 886 RRRRSPSPPPRRRRRDSYSPSRRRRDSPTPSPPPRRRRKSPSPSPPRRRRRSPSNSPPPM 945 Query: 354 RLGDTP*AVHRSHLAPPHHRTNSRVPGTPAPGTRQPLREMNGXXXXXXXXXXXXXXXRRG 533 R P + PP R R +P RQ N R Sbjct: 946 RSSPLPPPQRKRASTPPSPRRARRKVASPEEQDRQKSNGRNSRSVSPSAVKRTKGSKRSE 1005 Query: 534 IHSLSRS 554 S+SRS Sbjct: 1006 SRSVSRS 1012 Score = 29.5 bits (63), Expect = 3.2 Identities = 32/109 (29%), Positives = 44/109 (40%), Gaps = 7/109 (6%) Frame = +2 Query: 134 PSPPPISHRRLRLEKGARSTCPAERLPTK--PHRAPPLRLHETHGTAQCAPKARRRRYPS 307 PSP R R RS P +R P + P +PP R ++ + RRR Sbjct: 1073 PSPRRTPEDRRRSRGSRRSPSPPKREPRRRSPSASPPRREARKRSLSRSPKREVRRR--- 1129 Query: 308 C**DGTPSPGKXXXXXXXXXXXXGAQE-PPCAA---SP-PDQQPSTGHP 439 G+PSP + G +E PPC A SP D++P+ P Sbjct: 1130 ----GSPSPSE--GRKKPVDVEMGEEEAPPCKAARKSPSADEEPAEEAP 1172 >SB_27758| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1926 Score = 33.9 bits (74), Expect = 0.15 Identities = 20/40 (50%), Positives = 23/40 (57%), Gaps = 2/40 (5%) Frame = +2 Query: 383 QEPPCAASPPDQQPSTGHPRTRHP--TAPTGDERELRARA 496 QEPP + P QQ GHP TR P TAPT ++ ARA Sbjct: 1727 QEPP--SRPDPQQVGRGHPSTREPQRTAPTPRTQQPPARA 1764 >SB_379| Best HMM Match : ADK (HMM E-Value=3.2e-05) Length = 991 Score = 33.9 bits (74), Expect = 0.15 Identities = 17/79 (21%), Positives = 35/79 (44%) Frame = +3 Query: 192 LAPQNDYRLNPIEPHHSDSTKPTVPHSARRRLAVAGTHPVNRTALHPRENPAGRRLGDTP 371 + P+++ I+P H+ + P R + H +NRT + P N R+ Sbjct: 896 IEPEHNMNRTRIKPEHNMNRTRIEPEHNMNRTRIKPEHNMNRTRIEPEHNMNRTRIKPEH 955 Query: 372 *AVHRSHLAPPHHRTNSRV 428 ++R+ + P H+ +R+ Sbjct: 956 -NMNRTRIKPEHNMNRTRI 973 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/53 (26%), Positives = 23/53 (43%) Frame = +3 Query: 183 REALAPQNDYRLNPIEPHHSDSTKPTVPHSARRRLAVAGTHPVNRTALHPREN 341 R + P+++ IEP H+ + P R + H +NRT + P N Sbjct: 904 RTRIKPEHNMNRTRIEPEHNMNRTRIKPEHNMNRTRIEPEHNMNRTRIKPEHN 956 Score = 29.5 bits (63), Expect = 3.2 Identities = 13/53 (24%), Positives = 23/53 (43%) Frame = +3 Query: 183 REALAPQNDYRLNPIEPHHSDSTKPTVPHSARRRLAVAGTHPVNRTALHPREN 341 R + P+++ I+P H+ + P R + H +NRT + P N Sbjct: 915 RTRIEPEHNMNRTRIKPEHNMNRTRIEPEHNMNRTRIKPEHNMNRTRIKPEHN 967 Score = 28.3 bits (60), Expect = 7.5 Identities = 13/53 (24%), Positives = 22/53 (41%) Frame = +3 Query: 183 REALAPQNDYRLNPIEPHHSDSTKPTVPHSARRRLAVAGTHPVNRTALHPREN 341 R + P+++ IEP H+ + P R + H +NRT + N Sbjct: 926 RTRIKPEHNMNRTRIEPEHNMNRTRIKPEHNMNRTRIKPEHNMNRTRIEAERN 978 >SB_22890| Best HMM Match : 2OG-FeII_Oxy (HMM E-Value=0.00078) Length = 788 Score = 31.9 bits (69), Expect = 0.61 Identities = 17/50 (34%), Positives = 26/50 (52%), Gaps = 3/50 (6%) Frame = +3 Query: 132 VLHLPQFLTG---DYALKKAREALAPQNDYRLNPIEPHHSDSTKPTVPHS 272 + +P FL+ DY LKKA++A +D L+PI + + T HS Sbjct: 412 IFEIPNFLSDEECDYILKKAKKAGMHSSDIHLDPITDKYKKMIRSTEGHS 461 >SB_55326| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1289 Score = 31.5 bits (68), Expect = 0.80 Identities = 19/50 (38%), Positives = 28/50 (56%), Gaps = 3/50 (6%) Frame = +2 Query: 425 STGHPRTRHPTAPTGDERELRARAAHSAFF---AVKPKRDPLPFALLSLT 565 + GHPR +H T P G +RE+R++A+ +A P PL A S+T Sbjct: 94 AVGHPRVQHVTDP-GIDREVRSKASATARVHAEGAAPAPSPLMHAAHSMT 142 >SB_7913| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 336 Score = 30.7 bits (66), Expect = 1.4 Identities = 20/85 (23%), Positives = 38/85 (44%) Frame = +3 Query: 201 QNDYRLNPIEPHHSDSTKPTVPHSARRRLAVAGTHPVNRTALHPRENPAGRRLGDTP*AV 380 + +++ +P+ H S S +P + +RR + + H + +P RR +P Sbjct: 185 EEEHKESPVH-HRSLSPEPRRGYRDQRRRSHSPAHHRRSRSRSRSRSPRRRRRSRSPRRR 243 Query: 381 HRSHLAPPHHRTNSRVPGTPAPGTR 455 RS PHHR++ + +P R Sbjct: 244 RRSRSPSPHHRSHRSRSRSRSPRRR 268 >SB_1528| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2409 Score = 30.7 bits (66), Expect = 1.4 Identities = 15/48 (31%), Positives = 22/48 (45%) Frame = +2 Query: 122 KSRGPSPPPISHRRLRLEKGARSTCPAERLPTKPHRAPPLRLHETHGT 265 K +GP P+ L ++GAR + R PT P L + +T T Sbjct: 1432 KHKGPKSDPVKSTTLSEDEGARPLDDSNRTPTSPAAPKTLWMDQTQPT 1479 >SB_32600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1572 Score = 30.3 bits (65), Expect = 1.8 Identities = 32/116 (27%), Positives = 37/116 (31%), Gaps = 6/116 (5%) Frame = +2 Query: 134 PSPPPISHRRLR--LEKGARSTCPAERLPTKPHRAP----PLRLHETHGTAQCAPKARRR 295 P P + H R+R P R+P P RAP P R + G +Q P Sbjct: 300 PPPQYMPHPRMRPPTRIPPPGMGPPPRIPPPPIRAPVDVYPPRAPQ--GASQTPP----- 352 Query: 296 RYPSC**DGTPSPGKXXXXXXXXXXXXGAQEPPCAASPPDQQPSTGHPRTRHPTAP 463 YP P P PP A P P HPR P AP Sbjct: 353 -YPGSHYSRVPPPDGPYTRALPPGEPYARMPPPGATHPRVPSPGASHPRVPPPGAP 407 Score = 28.3 bits (60), Expect = 7.5 Identities = 30/109 (27%), Positives = 32/109 (29%), Gaps = 1/109 (0%) Frame = +2 Query: 140 PPPISHRRLRLEKGARSTCPAERLPTKPH-RAPPLRLHETHGTAQCAPKARRRRYPSC** 316 PP H+R+ P P PH R PP AP R P Sbjct: 493 PPGAPHQRVPPPGAPHPRVPP---PGAPHPRVPPPGAPHPRVPPPGAPHPRVPP-PGAPH 548 Query: 317 DGTPSPGKXXXXXXXXXXXXGAQEPPCAASPPDQQPSTGHPRTRHPTAP 463 P PG PP A P P T HPR P AP Sbjct: 549 PRVPPPGASHPRVPPPGAPHPRVPPPGAPHPRVPPPGTPHPRVPPPGAP 597 >SB_34170| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 330 Score = 29.9 bits (64), Expect = 2.4 Identities = 18/49 (36%), Positives = 30/49 (61%), Gaps = 2/49 (4%) Frame = +3 Query: 141 LPQFLTGDYALKKAREALAPQNDYRLNPIEPHHSD--STKPTVPHSARR 281 L + LTG+ + + A AP+++ LNPI P+ + +T PTVP ++R Sbjct: 280 LNEVLTGETSAEPA----APEDEDYLNPIAPNSNKHLATMPTVPRRSQR 324 >SB_56440| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1142 Score = 29.9 bits (64), Expect = 2.4 Identities = 16/58 (27%), Positives = 26/58 (44%) Frame = +3 Query: 198 PQNDYRLNPIEPHHSDSTKPTVPHSARRRLAVAGTHPVNRTALHPRENPAGRRLGDTP 371 P N + NP PH+S + P P + R+ P N +HP+ +P ++ P Sbjct: 324 PHNGRKSNPNPPHNSRKSNPNPPLNGRKS---NPNPPHNGPKVHPQPSPQWPKVHPQP 378 Score = 28.7 bits (61), Expect = 5.6 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = +3 Query: 198 PQNDYRLNPIEPHHSDSTKPTVPHSARR 281 P N + NP PH+ + P PH++R+ Sbjct: 313 PLNGRKSNPNPPHNGRKSNPNPPHNSRK 340 >SB_54480| Best HMM Match : Folate_rec (HMM E-Value=1.5) Length = 635 Score = 29.9 bits (64), Expect = 2.4 Identities = 16/35 (45%), Positives = 21/35 (60%), Gaps = 1/35 (2%) Frame = +2 Query: 200 AERLPTKPHRAPPL-RLHETHGTAQCAPKARRRRY 301 A + T P R PPL RLH+T +A CA R++ Y Sbjct: 143 ARTVQTSPDRQPPLYRLHQT-DSAHCADYTRQKVY 176 >SB_56900| Best HMM Match : I-set (HMM E-Value=8e-10) Length = 968 Score = 29.5 bits (63), Expect = 3.2 Identities = 23/80 (28%), Positives = 31/80 (38%), Gaps = 2/80 (2%) Frame = +3 Query: 213 RLNPIEPHHSDSTKPTVPHSARRRLAVAGTHPVNRTALHPRENPAGRRL--GDTP*AVHR 386 RL+ H + P+ H RL TH T +HPR + TP HR Sbjct: 806 RLHTEYTHAYTPSTPSPTHRVHTRLHTKYTHAY--TPIHPRLHAEYTHAYTPSTPKPTHR 863 Query: 387 SHLAPPHHRTNSRVPGTPAP 446 H + T++ P TP P Sbjct: 864 VHPSLHAGYTHTYTPSTPTP 883 >SB_20563| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 238 Score = 29.5 bits (63), Expect = 3.2 Identities = 25/72 (34%), Positives = 30/72 (41%), Gaps = 4/72 (5%) Frame = +3 Query: 237 HSDSTKPTV---PHSARRRLAVA-GTHPVNRTALHPRENPAGRRLGDTP*AVHRSHLAPP 404 +S ST+P + H RRL V +HP R L NPA P V SHL Sbjct: 123 YSSSTQPCIVFDSHLTGRRLRVVFKSHPTPRR-LQVALNPASSSSRTKPCVVFDSHLTRR 181 Query: 405 HHRTNSRVPGTP 440 HR + TP Sbjct: 182 RHRVVLKSHPTP 193 >SB_58981| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 794 Score = 29.1 bits (62), Expect = 4.3 Identities = 14/30 (46%), Positives = 16/30 (53%), Gaps = 1/30 (3%) Frame = +2 Query: 392 PCAASPPDQQPSTGHPRTRHPTA-PTGDER 478 P PD QPST H R P+A PT D + Sbjct: 760 PSTVHTPDNQPSTVHTRGSQPSAVPTQDSQ 789 >SB_58632| Best HMM Match : Flp_Fap (HMM E-Value=1.1) Length = 297 Score = 29.1 bits (62), Expect = 4.3 Identities = 20/57 (35%), Positives = 25/57 (43%), Gaps = 1/57 (1%) Frame = +3 Query: 216 LNPIEPHHSDSTKPTVPHSARRRLAVAGTH-PVNRTALHPRENPAGRRLGDTP*AVH 383 L P +P +S P S+R A+ P R AL PR +P R G T VH Sbjct: 29 LIPFDPDDGESI-PMTSTSSRTHAAIGRLRKPQKRQALKPRSSPRLSRKGKTEIQVH 84 >SB_26888| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 29.1 bits (62), Expect = 4.3 Identities = 13/26 (50%), Positives = 19/26 (73%) Frame = +2 Query: 431 GHPRTRHPTAPTGDERELRARAAHSA 508 GHPR +H T P G +RE+R++A+ A Sbjct: 23 GHPRVQHVTDP-GIDREVRSKASAPA 47 >SB_24017| Best HMM Match : DUF646 (HMM E-Value=4.1) Length = 486 Score = 29.1 bits (62), Expect = 4.3 Identities = 13/26 (50%), Positives = 19/26 (73%) Frame = +2 Query: 431 GHPRTRHPTAPTGDERELRARAAHSA 508 GHPR +H T P G +RE+R++A+ A Sbjct: 399 GHPRVQHVTDP-GIDREVRSKASAPA 423 >SB_8656| Best HMM Match : Chorion_3 (HMM E-Value=2.4) Length = 352 Score = 29.1 bits (62), Expect = 4.3 Identities = 13/26 (50%), Positives = 19/26 (73%) Frame = +2 Query: 431 GHPRTRHPTAPTGDERELRARAAHSA 508 GHPR +H T P G +RE+R++A+ A Sbjct: 270 GHPRVQHVTDP-GIDREVRSKASAPA 294 >SB_39424| Best HMM Match : Pox_A32 (HMM E-Value=0.033) Length = 1004 Score = 29.1 bits (62), Expect = 4.3 Identities = 13/26 (50%), Positives = 19/26 (73%) Frame = +2 Query: 431 GHPRTRHPTAPTGDERELRARAAHSA 508 GHPR +H T P G +RE+R++A+ A Sbjct: 297 GHPRVQHVTDP-GIDREVRSKASAPA 321 >SB_57266| Best HMM Match : POPLD (HMM E-Value=0.55) Length = 558 Score = 28.7 bits (61), Expect = 5.6 Identities = 14/22 (63%), Positives = 15/22 (68%), Gaps = 1/22 (4%) Frame = -3 Query: 681 PHRGAGERPLL-AGCHRPHXKG 619 PH GAG+RP AGCHR H G Sbjct: 41 PHPGAGKRPCSDAGCHR-HSMG 61 >SB_46006| Best HMM Match : MAAL_N (HMM E-Value=3.7) Length = 260 Score = 28.7 bits (61), Expect = 5.6 Identities = 13/26 (50%), Positives = 17/26 (65%) Frame = +2 Query: 425 STGHPRTRHPTAPTGDERELRARAAH 502 + GHPR +H T P D RE+R R +H Sbjct: 224 AAGHPRVQHVTDPRID-REVRRRHSH 248 >SB_33346| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1074 Score = 28.7 bits (61), Expect = 5.6 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +2 Query: 416 QQPSTGHPRTRHPTAPTGDERELRARAAHSAF 511 + P G R PT P+G ++E+R + SAF Sbjct: 198 EPPDNGVESARSPTTPSGTQQEVRVDSKLSAF 229 >SB_57323| Best HMM Match : ShTK (HMM E-Value=0) Length = 911 Score = 28.7 bits (61), Expect = 5.6 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = +2 Query: 386 EPPCAASPPDQQPSTGHPRTRHPTAP 463 +P C PD QP T P T+ P P Sbjct: 693 DPDCTTETPDTQPPTQPPVTQPPDTP 718 >SB_11299| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3762 Score = 28.7 bits (61), Expect = 5.6 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +2 Query: 395 CAASPPDQQPSTGHPRTRHPTAP 463 C P Q P G P+T PTAP Sbjct: 2323 CTICPACQTPKPGEPQTSQPTAP 2345 >SB_27312| Best HMM Match : Pox_A32 (HMM E-Value=0.012) Length = 1115 Score = 28.3 bits (60), Expect = 7.5 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +1 Query: 364 THRERCTGATLRRLTTGPTAEYRAPPHPAPD 456 THR A R GP AE A PH A D Sbjct: 641 THRRELAAAFTRTPAGGPGAERAADPHTAAD 671 >SB_19217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 468 Score = 28.3 bits (60), Expect = 7.5 Identities = 12/17 (70%), Positives = 13/17 (76%), Gaps = 1/17 (5%) Frame = -3 Query: 681 PHRGAGERPLL-AGCHR 634 PH GAG+RP AGCHR Sbjct: 39 PHPGAGKRPCSDAGCHR 55 >SB_40368| Best HMM Match : SASP_gamma (HMM E-Value=2.3) Length = 325 Score = 27.9 bits (59), Expect = 9.9 Identities = 29/118 (24%), Positives = 40/118 (33%), Gaps = 3/118 (2%) Frame = +2 Query: 119 EKSRGPS--PPPISHRRLRLEKGARSTCPAERLPTKPHRAPPLRLHETHGTAQCAPKARR 292 EK PS PP+ RR TCPAE+ PP++ G A+ P R Sbjct: 49 EKPHRPSRETPPVQPRR-------NPTCPAEKHHRSSKETPPVQPRNLAGPAE-KPHRSR 100 Query: 293 RRYPSC**DGTPSPGKXXXXXXXXXXXXGAQEPPCAASPPDQQPSTGHP-RTRHPTAP 463 R SP + + P A P + P + R+P +P Sbjct: 101 RETQLAQPRNPTSPAEKPHQSSKETQPVQQRNPAGPAKKPSRSSKETQPVQQRNPASP 158 >SB_38456| Best HMM Match : BTB (HMM E-Value=8.8e-26) Length = 1410 Score = 27.9 bits (59), Expect = 9.9 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = +2 Query: 392 PCAASPPDQQPSTGHPRTRHPTAPT 466 P +PP PST P T P PT Sbjct: 325 PATNAPPSDSPSTTTPTTPQPPTPT 349 >SB_30592| Best HMM Match : MAM (HMM E-Value=2.66247e-44) Length = 667 Score = 27.9 bits (59), Expect = 9.9 Identities = 12/27 (44%), Positives = 14/27 (51%) Frame = +2 Query: 392 PCAASPPDQQPSTGHPRTRHPTAPTGD 472 P PP P+T P T+ P PTGD Sbjct: 434 PPPTPPPTPPPTTLPPTTQPPPQPTGD 460 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,670,301 Number of Sequences: 59808 Number of extensions: 598464 Number of successful extensions: 2338 Number of sequences better than 10.0: 29 Number of HSP's better than 10.0 without gapping: 1903 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2311 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2155861620 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -