BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_T7_H10 (807 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF283275-1|AAG15376.1| 133|Anopheles gambiae small heat shock p... 27 0.52 AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/T... 26 1.2 AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/T... 26 1.2 >AF283275-1|AAG15376.1| 133|Anopheles gambiae small heat shock protein protein. Length = 133 Score = 27.5 bits (58), Expect = 0.52 Identities = 14/39 (35%), Positives = 21/39 (53%) Frame = +1 Query: 55 QNCEE*GIKILRRLQRSRKKHGEDLPTGGRSRRKGEKLE 171 Q EE I I Q ++ G+ P G S+++GEK+E Sbjct: 94 QKNEERSIPITHTGQPMKQVTGKAAPENGHSKKEGEKME 132 >AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1977 Score = 26.2 bits (55), Expect = 1.2 Identities = 14/43 (32%), Positives = 21/43 (48%) Frame = -2 Query: 230 VRQHQDGS*GQQNCSSLCIYSSFSPFLRDLPPVGRSSPCFFRL 102 +R+H S GQ C+ Y++ P R PV PC+ R+ Sbjct: 1822 LRKHHCRSCGQIFCAECSDYTAHLPEERLYQPVRLCGPCYQRI 1864 >AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1978 Score = 26.2 bits (55), Expect = 1.2 Identities = 14/43 (32%), Positives = 21/43 (48%) Frame = -2 Query: 230 VRQHQDGS*GQQNCSSLCIYSSFSPFLRDLPPVGRSSPCFFRL 102 +R+H S GQ C+ Y++ P R PV PC+ R+ Sbjct: 1823 LRKHHCRSCGQIFCAECSDYTAHLPEERLYQPVRLCGPCYQRI 1865 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 727,892 Number of Sequences: 2352 Number of extensions: 14268 Number of successful extensions: 28 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 28 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 28 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 85239615 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -