BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_T7_H06 (795 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC114377-1|AAI14378.1| 44|Homo sapiens Unknown (protein for MG... 54 6e-07 AL513550-4|CAI17194.1| 805|Homo sapiens RP11-98I9.2 protein. 31 3.6 AL080186-1|CAB45767.1| 299|Homo sapiens hypothetical protein pr... 31 3.6 AF314185-1|AAL76164.1| 283|Homo sapiens SR rich protein protein. 31 3.6 AF314184-1|AAL76163.1| 805|Homo sapiens SR rich protein protein. 31 3.6 BC006350-1|AAH06350.1| 619|Homo sapiens BUD13 homolog (S. cerev... 31 4.8 AK126665-1|BAC86634.1| 1012|Homo sapiens protein ( Homo sapiens ... 31 6.3 AB127405-1|BAD03968.1| 1183|Homo sapiens SNAP-25-interacting pro... 31 6.3 AB051471-1|BAB21775.1| 762|Homo sapiens KIAA1684 protein protein. 31 6.3 BC048251-1|AAH48251.1| 322|Homo sapiens ZDHHC12 protein protein. 30 8.4 AL441992-6|CAI15406.1| 210|Homo sapiens zinc finger, DHHC-type ... 30 8.4 >BC114377-1|AAI14378.1| 44|Homo sapiens Unknown (protein for MGC:134704) protein. Length = 44 Score = 54.0 bits (124), Expect = 6e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = +1 Query: 586 MIGRADIEGSKSNVAMNAWLPQASYP 663 MIGRADIEGSKS+VAMNAW PQASYP Sbjct: 1 MIGRADIEGSKSDVAMNAWPPQASYP 26 >AL513550-4|CAI17194.1| 805|Homo sapiens RP11-98I9.2 protein. Length = 805 Score = 31.5 bits (68), Expect = 3.6 Identities = 14/43 (32%), Positives = 27/43 (62%) Frame = +3 Query: 510 SRRSKPSSHSLLMGEQSNAWRILLRNDRKSRHRRVKKQRRYER 638 +RRS+ S+S + +SN R+ +R+ R+S ++++RR R Sbjct: 568 ARRSRSRSYSRRIKIESNRARVKIRDRRRSNRNSIERERRRNR 610 >AL080186-1|CAB45767.1| 299|Homo sapiens hypothetical protein protein. Length = 299 Score = 31.5 bits (68), Expect = 3.6 Identities = 14/43 (32%), Positives = 27/43 (62%) Frame = +3 Query: 510 SRRSKPSSHSLLMGEQSNAWRILLRNDRKSRHRRVKKQRRYER 638 +RRS+ S+S + +SN R+ +R+ R+S ++++RR R Sbjct: 62 ARRSRSRSYSRRIKIESNRARVKIRDRRRSNRNSIERERRRNR 104 >AF314185-1|AAL76164.1| 283|Homo sapiens SR rich protein protein. Length = 283 Score = 31.5 bits (68), Expect = 3.6 Identities = 14/43 (32%), Positives = 27/43 (62%) Frame = +3 Query: 510 SRRSKPSSHSLLMGEQSNAWRILLRNDRKSRHRRVKKQRRYER 638 +RRS+ S+S + +SN R+ +R+ R+S ++++RR R Sbjct: 46 ARRSRSRSYSRRIKIESNRARVKIRDRRRSNRNSIERERRRNR 88 >AF314184-1|AAL76163.1| 805|Homo sapiens SR rich protein protein. Length = 805 Score = 31.5 bits (68), Expect = 3.6 Identities = 14/43 (32%), Positives = 27/43 (62%) Frame = +3 Query: 510 SRRSKPSSHSLLMGEQSNAWRILLRNDRKSRHRRVKKQRRYER 638 +RRS+ S+S + +SN R+ +R+ R+S ++++RR R Sbjct: 568 ARRSRSRSYSRRIKIESNRARVKIRDRRRSNRNSIERERRRNR 610 >BC006350-1|AAH06350.1| 619|Homo sapiens BUD13 homolog (S. cerevisiae) protein. Length = 619 Score = 31.1 bits (67), Expect = 4.8 Identities = 18/45 (40%), Positives = 23/45 (51%) Frame = +2 Query: 35 AGLSLNRSQHDAALPSTTPRQERKSSTDYSEPRHRTELYPDLRSR 169 +G S R +HD+ PS PR+ R S+D S PR PD R Sbjct: 211 SGASPRRVRHDSPDPSP-PRRARHGSSDISSPRRVHNNSPDTSRR 254 >AK126665-1|BAC86634.1| 1012|Homo sapiens protein ( Homo sapiens cDNA FLJ44709 fis, clone BRACE3019570, highly similar to Rattus norvegicus SNAP-25-interacting protein (SNIP). ). Length = 1012 Score = 30.7 bits (66), Expect = 6.3 Identities = 21/52 (40%), Positives = 24/52 (46%) Frame = +3 Query: 387 ASHHRPLGRVHEPNVRNCGSSRTEQYYYRNDKPSVG*N*PVSRRSKPSSHSL 542 A H + EP+ R GS YR +KPS P RRS PSSH L Sbjct: 841 APHGQKAAPRTEPSGRR-GSDELTVPRYRTEKPSKSPPPPPPRRSFPSSHGL 891 >AB127405-1|BAD03968.1| 1183|Homo sapiens SNAP-25-interacting protein protein. Length = 1183 Score = 30.7 bits (66), Expect = 6.3 Identities = 21/52 (40%), Positives = 24/52 (46%) Frame = +3 Query: 387 ASHHRPLGRVHEPNVRNCGSSRTEQYYYRNDKPSVG*N*PVSRRSKPSSHSL 542 A H + EP+ R GS YR +KPS P RRS PSSH L Sbjct: 969 APHGQKAAPRTEPSGRR-GSDELTVPRYRTEKPSKSPPPPPPRRSFPSSHGL 1019 >AB051471-1|BAB21775.1| 762|Homo sapiens KIAA1684 protein protein. Length = 762 Score = 30.7 bits (66), Expect = 6.3 Identities = 21/52 (40%), Positives = 24/52 (46%) Frame = +3 Query: 387 ASHHRPLGRVHEPNVRNCGSSRTEQYYYRNDKPSVG*N*PVSRRSKPSSHSL 542 A H + EP+ R GS YR +KPS P RRS PSSH L Sbjct: 548 APHGQKAAPRTEPSGRR-GSDELTVPRYRTEKPSKSPPPPPPRRSFPSSHGL 598 >BC048251-1|AAH48251.1| 322|Homo sapiens ZDHHC12 protein protein. Length = 322 Score = 30.3 bits (65), Expect = 8.4 Identities = 13/25 (52%), Positives = 15/25 (60%) Frame = -2 Query: 362 TPLRPKPA*PNPARICSLWSPESRE 288 TP P P P PA +CS SPE R+ Sbjct: 68 TPTPPTPVLPGPASLCSPASPELRQ 92 >AL441992-6|CAI15406.1| 210|Homo sapiens zinc finger, DHHC-type containing 12 protein. Length = 210 Score = 30.3 bits (65), Expect = 8.4 Identities = 13/25 (52%), Positives = 15/25 (60%) Frame = -2 Query: 362 TPLRPKPA*PNPARICSLWSPESRE 288 TP P P P PA +CS SPE R+ Sbjct: 68 TPTPPTPVLPGPASLCSPASPELRQ 92 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 122,270,905 Number of Sequences: 237096 Number of extensions: 2740555 Number of successful extensions: 6319 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 5964 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6312 length of database: 76,859,062 effective HSP length: 89 effective length of database: 55,757,518 effective search space used: 9757565650 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -