BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_T7_H05 (777 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_11396| Best HMM Match : Ribosomal_S2 (HMM E-Value=0) 151 8e-37 SB_24578| Best HMM Match : rve (HMM E-Value=4.8e-35) 36 0.037 SB_57493| Best HMM Match : Surf_Ag_VNR (HMM E-Value=0.00037) 31 1.4 SB_40833| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_49472| Best HMM Match : BDS_I_II (HMM E-Value=1.5) 30 2.4 SB_4542| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 SB_58902| Best HMM Match : TNFR_c6 (HMM E-Value=0.032) 29 4.2 SB_8061| Best HMM Match : Homeobox (HMM E-Value=5.1e-27) 29 4.2 SB_726| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_51220| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.5 SB_33020| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.5 SB_4778| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.5 SB_49599| Best HMM Match : DDE (HMM E-Value=3.7e-20) 28 7.3 SB_50413| Best HMM Match : GRP (HMM E-Value=0.15) 28 7.3 SB_13671| Best HMM Match : RVT_1 (HMM E-Value=1.8e-11) 28 9.7 SB_8703| Best HMM Match : rve (HMM E-Value=1.5e-22) 28 9.7 SB_4520| Best HMM Match : Tsg (HMM E-Value=7.8) 28 9.7 >SB_11396| Best HMM Match : Ribosomal_S2 (HMM E-Value=0) Length = 328 Score = 151 bits (365), Expect = 8e-37 Identities = 67/91 (73%), Positives = 76/91 (83%) Frame = -1 Query: 630 REPRLLIVLDPAQDHQPITEASYVNIPVIALCNTDSPLRFVDIAIPCNTKSSHSIGLMWW 451 REPRLLIV DP DHQP+TEASYVNIPVIA CNTDSPLR VD+AIPCN K HSIGLM+W Sbjct: 117 REPRLLIVCDPRIDHQPVTEASYVNIPVIAFCNTDSPLRHVDVAIPCNNKGIHSIGLMFW 176 Query: 450 LLAREVLRLRGVLPRDQRWDVVVDLFFYRXP 358 LLAREVLR+RG + R W+++ DL+FYR P Sbjct: 177 LLAREVLRMRGSISRALPWEIMPDLYFYRDP 207 Score = 81.8 bits (193), Expect = 6e-16 Identities = 35/44 (79%), Positives = 40/44 (90%) Frame = -2 Query: 776 ENPXDVXVXSSRPFGQRAVLKFAAHTGATPIAGRFTPGAFTNQI 645 ENP DV V S+RP+GQRA+LK+A+HTGATPIAGRFTPG FTNQI Sbjct: 69 ENPADVCVISARPYGQRAILKYASHTGATPIAGRFTPGTFTNQI 112 >SB_24578| Best HMM Match : rve (HMM E-Value=4.8e-35) Length = 1772 Score = 35.9 bits (79), Expect = 0.037 Identities = 24/67 (35%), Positives = 33/67 (49%), Gaps = 4/67 (5%) Frame = +2 Query: 377 KSTTTSQRWSRGSTPRSLNTSRANNHHIKPIEWEDLVLHGIAMST-NLSGE---SVLHKA 544 K+TT RWS+G TP ++ H I L+ HG ST NL+ E VL++ Sbjct: 1396 KTTTDKTRWSKGQTPNGKVAQKSKFQH--GIAGTQLIYHGTGPSTKNLTTEQAKQVLNEN 1453 Query: 545 ITGMLTY 565 G +TY Sbjct: 1454 ELGTMTY 1460 >SB_57493| Best HMM Match : Surf_Ag_VNR (HMM E-Value=0.00037) Length = 432 Score = 30.7 bits (66), Expect = 1.4 Identities = 15/32 (46%), Positives = 22/32 (68%) Frame = -1 Query: 606 LDPAQDHQPITEASYVNIPVIALCNTDSPLRF 511 LDP +HQPIT+ + I ++A TD+PL+F Sbjct: 119 LDPDVEHQPITDRAEACICLVA---TDAPLKF 147 >SB_40833| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1300 Score = 30.3 bits (65), Expect = 1.8 Identities = 14/43 (32%), Positives = 22/43 (51%) Frame = -3 Query: 622 SSLDCIGPCTRPSTHY*SFICQHSCDCFVQHRLPTKICGHCYP 494 S+ DCI C+ PS F C+ +C T++C +C+P Sbjct: 880 SANDCI-TCSDPSNALIGFTCKANCTPGQFKNTATRVCENCHP 921 >SB_49472| Best HMM Match : BDS_I_II (HMM E-Value=1.5) Length = 315 Score = 29.9 bits (64), Expect = 2.4 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -1 Query: 474 HSIGLMWWLLAREVLRLRGVLP 409 H G +WW+L E LR + VLP Sbjct: 46 HDDGSVWWVLTSESLRAKAVLP 67 >SB_4542| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 987 Score = 29.5 bits (63), Expect = 3.2 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = -1 Query: 198 SCFWSTPCSRRMVCPGTR*VEHNCRRTSRRHRSA 97 +C W+ P R+ PG R H T+R H +A Sbjct: 904 TCSWALPAHYRVHVPGQRSASHEAFDTTRPHENA 937 >SB_58902| Best HMM Match : TNFR_c6 (HMM E-Value=0.032) Length = 397 Score = 29.1 bits (62), Expect = 4.2 Identities = 13/42 (30%), Positives = 22/42 (52%) Frame = -3 Query: 625 TSSLDCIGPCTRPSTHY*SFICQHSCDCFVQHRLPTKICGHC 500 TSSLD + PC+ S H+ + + C C+ +++ C C Sbjct: 331 TSSLDTLAPCSF-SCHFACDVNTNQCICYYGYQMSDNKCKAC 371 >SB_8061| Best HMM Match : Homeobox (HMM E-Value=5.1e-27) Length = 418 Score = 29.1 bits (62), Expect = 4.2 Identities = 15/41 (36%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = +3 Query: 372 RTNQPQHPSAGHGEA-HHEASTLHVPTTTTSNQ*SGKTWCC 491 R QP H ++ + A HH A LH P +TS + W C Sbjct: 176 RDGQPCHGASMNNFAYHHAADFLHYPPVSTSYMPAHPYWTC 216 >SB_726| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 29.1 bits (62), Expect = 4.2 Identities = 17/66 (25%), Positives = 29/66 (43%), Gaps = 3/66 (4%) Frame = +2 Query: 365 R*KNKSTTTSQRWSRGSTPRSLNTSRANNHHIKPIEWEDL---VLHGIAMSTNLSGESVL 535 R N+ T ++ STP + N+ ++P EW ++ H + L+GES Sbjct: 3 RGSNRRPTFKYKFGDSSTPFYSALKKQNDRSMRPWEWHEMKARYSHAQTLINALTGESKY 62 Query: 536 HKAITG 553 +TG Sbjct: 63 EFTLTG 68 >SB_51220| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1601 Score = 28.7 bits (61), Expect = 5.5 Identities = 15/41 (36%), Positives = 23/41 (56%) Frame = +2 Query: 416 TPRSLNTSRANNHHIKPIEWEDLVLHGIAMSTNLSGESVLH 538 T +SLN S N + P EW + V+ G+ LSG ++L+ Sbjct: 864 TAQSLNVSVDNLKFLAPTEWRE-VIPGLKQEILLSGSNMLN 903 >SB_33020| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 696 Score = 28.7 bits (61), Expect = 5.5 Identities = 19/64 (29%), Positives = 29/64 (45%), Gaps = 3/64 (4%) Frame = -1 Query: 651 PDPKLHSREPRLLIVLDPAQDHQPITEASYVNIPVIALCN---TDSPLRFVDIAIPCNTK 481 P PK + RE ++ ++DP + P+ Y PV T P R +IPC + Sbjct: 480 PTPKAYEREGKIYRLIDPERRGDPVECQIYPQYPVARREKRRPTSGP-RDTKPSIPCEDR 538 Query: 480 SSHS 469 S+S Sbjct: 539 LSNS 542 >SB_4778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 867 Score = 28.7 bits (61), Expect = 5.5 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = +3 Query: 597 QGPIQSRDEVHGNAAWDLVSKSTW 668 +GP + R EV+ N AW +V +W Sbjct: 513 RGPYEGRVEVYHNGAWGVVCDDSW 536 >SB_49599| Best HMM Match : DDE (HMM E-Value=3.7e-20) Length = 428 Score = 28.3 bits (60), Expect = 7.3 Identities = 19/52 (36%), Positives = 28/52 (53%), Gaps = 2/52 (3%) Frame = -1 Query: 630 REPR-LLIVLDPAQDHQPITEASYVNIPVIALC-NTDSPLRFVDIAIPCNTK 481 RE R +++ +D A H P + +Y NI +I L NT S + +D I N K Sbjct: 255 RENRNIMLFMDNAPCHTPSLKNTYCNIKIIFLSKNTTSKTQPLDSGIIANWK 306 >SB_50413| Best HMM Match : GRP (HMM E-Value=0.15) Length = 487 Score = 28.3 bits (60), Expect = 7.3 Identities = 17/50 (34%), Positives = 24/50 (48%), Gaps = 1/50 (2%) Frame = +1 Query: 367 VEEQINHNIPALVTGKHTTKPQHFTCQQPPHQTNRVGR-LGVAWDSNVHK 513 V Q+ + P +T HT+ T P HQ + +GR G DSNV + Sbjct: 242 VTNQMRGHEPRSITYNHTSITAPLTTGYPDHQGSYMGRYAGSVADSNVSR 291 >SB_13671| Best HMM Match : RVT_1 (HMM E-Value=1.8e-11) Length = 1702 Score = 27.9 bits (59), Expect = 9.7 Identities = 17/44 (38%), Positives = 26/44 (59%) Frame = -1 Query: 528 DSPLRFVDIAIPCNTKSSHSIGLMWWLLAREVLRLRGVLPRDQR 397 +SPL + I +PCNT +S+ W+LLA + ++ VL D R Sbjct: 495 ESPLSYDLILVPCNTPNSNH----WFLLA-VLPHMKAVLLLDSR 533 >SB_8703| Best HMM Match : rve (HMM E-Value=1.5e-22) Length = 382 Score = 27.9 bits (59), Expect = 9.7 Identities = 17/51 (33%), Positives = 23/51 (45%), Gaps = 2/51 (3%) Frame = -1 Query: 705 AHRCYAYCGTFHTRCFY*PDPKLHSREPRLL--IVLDPAQDHQPITEASYV 559 A +AY T H+ Y P + R PRL + L P H P A+Y+ Sbjct: 146 ARLVHAYNATKHSTTEYSPSYLMFGRNPRLPQDVTLGPDPVHDPQPYAAYI 196 >SB_4520| Best HMM Match : Tsg (HMM E-Value=7.8) Length = 594 Score = 27.9 bits (59), Expect = 9.7 Identities = 16/51 (31%), Positives = 25/51 (49%), Gaps = 4/51 (7%) Frame = +2 Query: 398 RWSRGSTPRSLNTSRA---NNHHIKPIEWE-DLVLHGIAMSTNLSGESVLH 538 RWS +TPR TS N H+ P+ + D+ H A + +L S ++ Sbjct: 62 RWSHATTPRGGGTSSVLALNLAHVPPVSGDYDVAFHKHAAAVHLEDWSTIN 112 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,287,652 Number of Sequences: 59808 Number of extensions: 490793 Number of successful extensions: 1226 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 1099 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1224 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2119930593 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -