BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_T7_G21 (818 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_23734| Best HMM Match : No HMM Matches (HMM E-Value=.) 247 1e-65 SB_23733| Best HMM Match : No HMM Matches (HMM E-Value=.) 247 1e-65 SB_56| Best HMM Match : Actin (HMM E-Value=0) 247 1e-65 SB_56628| Best HMM Match : Actin (HMM E-Value=0) 246 1e-65 SB_7187| Best HMM Match : No HMM Matches (HMM E-Value=.) 245 3e-65 SB_7190| Best HMM Match : No HMM Matches (HMM E-Value=.) 245 4e-65 SB_13344| Best HMM Match : Actin (HMM E-Value=1.5e-07) 216 2e-56 SB_26136| Best HMM Match : Actin (HMM E-Value=7.2e-10) 80 2e-15 SB_19204| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 2e-14 SB_6996| Best HMM Match : Actin (HMM E-Value=1.7e-07) 69 5e-12 SB_54| Best HMM Match : Actin (HMM E-Value=0) 58 6e-09 SB_22343| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_27656| Best HMM Match : Actin (HMM E-Value=4.79999e-40) 38 0.007 SB_30721| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_42882| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 30 2.6 SB_5589| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.5 SB_50207| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.0 SB_38754| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.9 SB_9926| Best HMM Match : DPPIV_N (HMM E-Value=0) 28 7.9 >SB_23734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 338 Score = 247 bits (604), Expect = 1e-65 Identities = 113/119 (94%), Positives = 117/119 (98%) Frame = -1 Query: 686 CPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKE 507 CPEA+FQPSFLGME+ GIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKE Sbjct: 220 CPEAMFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKE 279 Query: 506 ITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 330 I+ALAP TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP+IVHRKCF Sbjct: 280 ISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPAIVHRKCF 338 Score = 31.9 bits (69), Expect = 0.64 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -2 Query: 736 YEXPDGQVITIGNE 695 YE PDGQVITIGNE Sbjct: 203 YELPDGQVITIGNE 216 >SB_23733| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 376 Score = 247 bits (604), Expect = 1e-65 Identities = 113/119 (94%), Positives = 117/119 (98%) Frame = -1 Query: 686 CPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKE 507 CPEA+FQPSFLGME+ GIHETTYNSIMKCDVDIRKDLYANTVLSGG+TMYPGIADRMQKE Sbjct: 258 CPEAMFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKE 317 Query: 506 ITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 330 IT+LAP TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF Sbjct: 318 ITSLAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376 Score = 31.9 bits (69), Expect = 0.64 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -2 Query: 736 YEXPDGQVITIGNE 695 YE PDGQVITIGNE Sbjct: 241 YELPDGQVITIGNE 254 >SB_56| Best HMM Match : Actin (HMM E-Value=0) Length = 375 Score = 247 bits (604), Expect = 1e-65 Identities = 113/119 (94%), Positives = 117/119 (98%) Frame = -1 Query: 686 CPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKE 507 CPEA+FQPSFLGME+ GIHETTYNSIMKCDVDIRKDLYANTVLSGG+TMYPGIADRMQKE Sbjct: 257 CPEAMFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKE 316 Query: 506 ITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 330 IT+LAP TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF Sbjct: 317 ITSLAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375 Score = 31.9 bits (69), Expect = 0.64 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -2 Query: 736 YEXPDGQVITIGNE 695 YE PDGQVITIGNE Sbjct: 240 YELPDGQVITIGNE 253 >SB_56628| Best HMM Match : Actin (HMM E-Value=0) Length = 376 Score = 246 bits (603), Expect = 1e-65 Identities = 113/119 (94%), Positives = 117/119 (98%) Frame = -1 Query: 686 CPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKE 507 CPEA+FQPSFLGME+ GIHETTYNSIMKCDVDIRKDLYANTVLSGG+TMYPGIADRMQKE Sbjct: 258 CPEAMFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKE 317 Query: 506 ITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 330 I+ALAP TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF Sbjct: 318 ISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376 Score = 31.9 bits (69), Expect = 0.64 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -2 Query: 736 YEXPDGQVITIGNE 695 YE PDGQVITIGNE Sbjct: 241 YELPDGQVITIGNE 254 >SB_7187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 349 Score = 245 bits (600), Expect = 3e-65 Identities = 112/119 (94%), Positives = 117/119 (98%) Frame = -1 Query: 686 CPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKE 507 CPEAL QPSFLGME+ GIHETTYNSIMKCDVDIRKDLYANTV+SGGTTMYPG+ADRMQKE Sbjct: 231 CPEALLQPSFLGMESSGIHETTYNSIMKCDVDIRKDLYANTVMSGGTTMYPGLADRMQKE 290 Query: 506 ITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 330 I+ALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP+IVHRKCF Sbjct: 291 ISALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPAIVHRKCF 349 Score = 31.9 bits (69), Expect = 0.64 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -2 Query: 736 YEXPDGQVITIGNE 695 YE PDGQVITIGNE Sbjct: 214 YELPDGQVITIGNE 227 >SB_7190| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 375 Score = 245 bits (599), Expect = 4e-65 Identities = 112/119 (94%), Positives = 117/119 (98%) Frame = -1 Query: 686 CPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKE 507 CPEA+FQPSFLGME+ GIHETTYNSIMKCDVDIRKDLYANTVLSGG+TM+PGIADRMQKE Sbjct: 257 CPEAMFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMFPGIADRMQKE 316 Query: 506 ITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 330 I+ALAP TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF Sbjct: 317 ISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375 Score = 31.9 bits (69), Expect = 0.64 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -2 Query: 736 YEXPDGQVITIGNE 695 YE PDGQVITIGNE Sbjct: 240 YELPDGQVITIGNE 253 >SB_13344| Best HMM Match : Actin (HMM E-Value=1.5e-07) Length = 149 Score = 216 bits (528), Expect = 2e-56 Identities = 97/119 (81%), Positives = 108/119 (90%) Frame = -1 Query: 686 CPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKE 507 CPEA+FQP+FLGMEA GIHE YN IMKCDVDIRKDLY+N VLSGG+TM+PGIADRMQKE Sbjct: 31 CPEAMFQPAFLGMEAPGIHEAIYNCIMKCDVDIRKDLYSNCVLSGGSTMFPGIADRMQKE 90 Query: 506 ITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 330 I LA ++MK+K+IAPPERKYSVWIGGSILASLSTFQQMWI+K+EY E GP IVHRKCF Sbjct: 91 IAMLANASMKVKVIAPPERKYSVWIGGSILASLSTFQQMWIAKEEYHEYGPPIVHRKCF 149 Score = 30.3 bits (65), Expect = 2.0 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -2 Query: 736 YEXPDGQVITIGNE 695 YE PDGQVI+IGNE Sbjct: 14 YELPDGQVISIGNE 27 >SB_26136| Best HMM Match : Actin (HMM E-Value=7.2e-10) Length = 543 Score = 79.8 bits (188), Expect = 2e-15 Identities = 47/139 (33%), Positives = 70/139 (50%), Gaps = 17/139 (12%) Frame = -1 Query: 683 PEALFQPSFLGME-ACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKE 507 PE F P F + + E N I C +D+R+ LY N VLSGG+TM+ R+Q++ Sbjct: 206 PEIFFHPEFSNPDFTTPLSEVVDNVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRD 265 Query: 506 IT----------------ALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQ 375 I + P ++ ++I+ ++Y+VW GGS+LAS F + +K Sbjct: 266 IKRTVDARLKMSETLSGGRIKPKPIETQVISHHMQRYAVWFGGSMLASTPEFYSVCHTKA 325 Query: 374 EYDESGPSIVHRKCF*THR 318 +YDE GPSI F HR Sbjct: 326 DYDEHGPSICRHNPF-LHR 343 >SB_19204| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 411 Score = 77.0 bits (181), Expect = 2e-14 Identities = 49/138 (35%), Positives = 73/138 (52%), Gaps = 29/138 (21%) Frame = -1 Query: 683 PEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEI 504 PEALFQP + +E G+ E +N+I D+D R + Y + VLSGG+TMYPG+ R+++EI Sbjct: 262 PEALFQPHLINVEGVGVAELLFNTIQAADIDTRSEFYKHIVLSGGSTMYPGLPSRLEREI 321 Query: 503 TAL---------------------APST-----MKIKI-IAPP-ERKYSVWIGGSILAS- 411 L P T K KI I P RK+ V++GG++LA Sbjct: 322 KQLYLERVLKGDTSKLSSGMGMEQIPLTADYLLQKFKIRIEDPPRRKHMVFMGGAVLADI 381 Query: 410 LSTFQQMWISKQEYDESG 357 + W++++EY+E G Sbjct: 382 MKDKDSFWMTRKEYEEKG 399 >SB_6996| Best HMM Match : Actin (HMM E-Value=1.7e-07) Length = 240 Score = 68.9 bits (161), Expect = 5e-12 Identities = 30/85 (35%), Positives = 54/85 (63%), Gaps = 3/85 (3%) Frame = -1 Query: 653 GMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKI 474 G A G+ + S+ D+DIR L+ + +++GG T+ G +R+ +E+ + P +M++ Sbjct: 146 GSTAMGVTQVVTTSVGMTDIDIRAGLFNSVIVTGGNTLLQGFVERLNRELVSKTPPSMRL 205 Query: 473 KII---APPERKYSVWIGGSILASL 408 K+I + E++++ WIGGSILASL Sbjct: 206 KLISNNSSVEKRFNPWIGGSILASL 230 >SB_54| Best HMM Match : Actin (HMM E-Value=0) Length = 2486 Score = 58.4 bits (135), Expect = 6e-09 Identities = 25/43 (58%), Positives = 32/43 (74%) Frame = -1 Query: 680 EALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSG 552 E LFQPS LG + GIHE+ + SI KCD+D+R +L+ N VLSG Sbjct: 2304 EPLFQPSLLGRDIDGIHESIFKSIKKCDIDLRAELFHNIVLSG 2346 >SB_22343| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 245 Score = 52.4 bits (120), Expect = 4e-07 Identities = 30/94 (31%), Positives = 45/94 (47%), Gaps = 9/94 (9%) Frame = -1 Query: 617 NSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPS--------TMKIKIIA 462 +S++ C +D RK L N VL GGT M PG R+ +EI L S +K+ Sbjct: 64 DSLLLCPIDTRKTLAENIVLIGGTAMTPGFKHRLMQEIYLLLQSPKYKDKLFIKTVKMHQ 123 Query: 461 PP-ERKYSVWIGGSILASLSTFQQMWISKQEYDE 363 PP + W+GG+I SL +++ Y + Sbjct: 124 PPVNANITAWLGGAIFGSLEVLADRSTTRERYQQ 157 >SB_27656| Best HMM Match : Actin (HMM E-Value=4.79999e-40) Length = 367 Score = 38.3 bits (85), Expect = 0.007 Identities = 15/28 (53%), Positives = 23/28 (82%) Frame = -1 Query: 614 SIMKCDVDIRKDLYANTVLSGGTTMYPG 531 +I K D+D+R+ LY+N VLSGG+T++ G Sbjct: 264 AIQKSDLDLRRVLYSNIVLSGGSTLFKG 291 >SB_30721| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 40 Score = 31.9 bits (69), Expect = 0.64 Identities = 13/20 (65%), Positives = 15/20 (75%) Frame = -1 Query: 683 PEALFQPSFLGMEACGIHET 624 PE +FQPS LG+E GI ET Sbjct: 3 PEIIFQPSMLGLEQAGITET 22 >SB_42882| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 1973 Score = 29.9 bits (64), Expect = 2.6 Identities = 17/62 (27%), Positives = 31/62 (50%), Gaps = 2/62 (3%) Frame = +1 Query: 421 IDPPIHTEYFLSGGAMILIFIVDGARAVISFCIRSAIPGYMV-VPPD-NTVLAYKSLRMS 594 +DPP+ +Y L+GG ++ + FCI G++V PP+ N+ + R++ Sbjct: 758 LDPPLENKYNLNGGQQVIQSTLQIQSLFFPFCI---FQGFVVPTPPECNSAIVLPDARIT 814 Query: 595 TS 600 S Sbjct: 815 AS 816 >SB_5589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 583 Score = 29.1 bits (62), Expect = 4.5 Identities = 15/40 (37%), Positives = 20/40 (50%) Frame = -2 Query: 448 STPYGSVDRSSPPSLPSNKCGSRNKSTTSLAPPLYTGSAS 329 STP +V PP PSN+ + +K S +P T S S Sbjct: 217 STPQATVQTPPPPPEPSNEPSTSSKPKASPSPSSITTSTS 256 >SB_50207| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 318 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/37 (32%), Positives = 15/37 (40%) Frame = -2 Query: 406 LPSNKCGSRNKSTTSLAPPLYTGSASKRTARRCLQQP 296 L C SR K P Y G RT ++C +P Sbjct: 118 LVKRTCNSRKKKKPEKRPSSYNGDTDYRTRKQCRYEP 154 >SB_38754| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 28.3 bits (60), Expect = 7.9 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = -1 Query: 569 NTVLSGGTTMYPGIADRMQKEITALAP 489 N ++GG TMY R+++E+ A+ P Sbjct: 132 NVFVTGGNTMYNNFMARLERELLAIRP 158 >SB_9926| Best HMM Match : DPPIV_N (HMM E-Value=0) Length = 1066 Score = 28.3 bits (60), Expect = 7.9 Identities = 13/42 (30%), Positives = 23/42 (54%), Gaps = 2/42 (4%) Frame = -2 Query: 403 PSNKCGSRNKSTTSLAPPLYTGSASK--RTARRCLQQPAAGC 284 P N+ G++ + +L P++TGS + RT + P+A C Sbjct: 879 PGNQAGNKTRPLRALRSPIHTGSTLEVDRTRQGTRPDPSARC 920 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,357,233 Number of Sequences: 59808 Number of extensions: 468212 Number of successful extensions: 1379 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 1260 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1375 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2287608719 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -