BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_T7_G20 (804 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EF426194-1|ABO26437.1| 133|Anopheles gambiae unknown protein. 24 4.8 EF426193-1|ABO26436.1| 133|Anopheles gambiae unknown protein. 24 4.8 EF426192-1|ABO26435.1| 133|Anopheles gambiae unknown protein. 24 4.8 EF426191-1|ABO26434.1| 133|Anopheles gambiae unknown protein. 24 4.8 EF426190-1|ABO26433.1| 133|Anopheles gambiae unknown protein. 24 4.8 EF426189-1|ABO26432.1| 133|Anopheles gambiae unknown protein. 24 4.8 EF426188-1|ABO26431.1| 133|Anopheles gambiae unknown protein. 24 4.8 EF426187-1|ABO26430.1| 133|Anopheles gambiae unknown protein. 24 4.8 EF426185-1|ABO26428.1| 133|Anopheles gambiae unknown protein. 24 4.8 EF426184-1|ABO26427.1| 133|Anopheles gambiae unknown protein. 24 4.8 EF426183-1|ABO26426.1| 133|Anopheles gambiae unknown protein. 24 4.8 EF426182-1|ABO26425.1| 133|Anopheles gambiae unknown protein. 24 4.8 EF426181-1|ABO26424.1| 133|Anopheles gambiae unknown protein. 24 4.8 EF426180-1|ABO26423.1| 133|Anopheles gambiae unknown protein. 24 4.8 EF426179-1|ABO26422.1| 133|Anopheles gambiae unknown protein. 24 4.8 L04753-1|AAA29357.1| 511|Anopheles gambiae alpha-amylase protein. 24 6.3 EF426186-1|ABO26429.1| 133|Anopheles gambiae unknown protein. 24 6.3 >EF426194-1|ABO26437.1| 133|Anopheles gambiae unknown protein. Length = 133 Score = 24.2 bits (50), Expect = 4.8 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = -1 Query: 651 VTLYKTCIRPRHDLCKCSVRSRGPH 577 +TL TC P D CK R PH Sbjct: 60 LTLTHTCNTPWADCCKVDEPGRVPH 84 >EF426193-1|ABO26436.1| 133|Anopheles gambiae unknown protein. Length = 133 Score = 24.2 bits (50), Expect = 4.8 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = -1 Query: 651 VTLYKTCIRPRHDLCKCSVRSRGPH 577 +TL TC P D CK R PH Sbjct: 60 LTLTHTCNTPWADCCKVDEPGRVPH 84 >EF426192-1|ABO26435.1| 133|Anopheles gambiae unknown protein. Length = 133 Score = 24.2 bits (50), Expect = 4.8 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = -1 Query: 651 VTLYKTCIRPRHDLCKCSVRSRGPH 577 +TL TC P D CK R PH Sbjct: 60 LTLTHTCNTPWADCCKVDEPGRVPH 84 >EF426191-1|ABO26434.1| 133|Anopheles gambiae unknown protein. Length = 133 Score = 24.2 bits (50), Expect = 4.8 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = -1 Query: 651 VTLYKTCIRPRHDLCKCSVRSRGPH 577 +TL TC P D CK R PH Sbjct: 60 LTLTHTCNTPWADCCKVDEPGRVPH 84 >EF426190-1|ABO26433.1| 133|Anopheles gambiae unknown protein. Length = 133 Score = 24.2 bits (50), Expect = 4.8 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = -1 Query: 651 VTLYKTCIRPRHDLCKCSVRSRGPH 577 +TL TC P D CK R PH Sbjct: 60 LTLTHTCNTPWADCCKVDEPGRVPH 84 >EF426189-1|ABO26432.1| 133|Anopheles gambiae unknown protein. Length = 133 Score = 24.2 bits (50), Expect = 4.8 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = -1 Query: 651 VTLYKTCIRPRHDLCKCSVRSRGPH 577 +TL TC P D CK R PH Sbjct: 60 LTLTHTCNTPWADCCKVDEPGRVPH 84 >EF426188-1|ABO26431.1| 133|Anopheles gambiae unknown protein. Length = 133 Score = 24.2 bits (50), Expect = 4.8 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = -1 Query: 651 VTLYKTCIRPRHDLCKCSVRSRGPH 577 +TL TC P D CK R PH Sbjct: 60 LTLTHTCNTPWADCCKVDEPGRVPH 84 >EF426187-1|ABO26430.1| 133|Anopheles gambiae unknown protein. Length = 133 Score = 24.2 bits (50), Expect = 4.8 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = -1 Query: 651 VTLYKTCIRPRHDLCKCSVRSRGPH 577 +TL TC P D CK R PH Sbjct: 60 LTLTHTCNTPWADCCKVDEPGRVPH 84 >EF426185-1|ABO26428.1| 133|Anopheles gambiae unknown protein. Length = 133 Score = 24.2 bits (50), Expect = 4.8 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = -1 Query: 651 VTLYKTCIRPRHDLCKCSVRSRGPH 577 +TL TC P D CK R PH Sbjct: 60 LTLTHTCNTPWADCCKVDEPGRVPH 84 >EF426184-1|ABO26427.1| 133|Anopheles gambiae unknown protein. Length = 133 Score = 24.2 bits (50), Expect = 4.8 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = -1 Query: 651 VTLYKTCIRPRHDLCKCSVRSRGPH 577 +TL TC P D CK R PH Sbjct: 60 LTLTHTCNTPWADCCKVDEPGRVPH 84 >EF426183-1|ABO26426.1| 133|Anopheles gambiae unknown protein. Length = 133 Score = 24.2 bits (50), Expect = 4.8 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = -1 Query: 651 VTLYKTCIRPRHDLCKCSVRSRGPH 577 +TL TC P D CK R PH Sbjct: 60 LTLTHTCNTPWADCCKVDEPGRVPH 84 >EF426182-1|ABO26425.1| 133|Anopheles gambiae unknown protein. Length = 133 Score = 24.2 bits (50), Expect = 4.8 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = -1 Query: 651 VTLYKTCIRPRHDLCKCSVRSRGPH 577 +TL TC P D CK R PH Sbjct: 60 LTLTHTCNTPWADCCKVDEPGRVPH 84 >EF426181-1|ABO26424.1| 133|Anopheles gambiae unknown protein. Length = 133 Score = 24.2 bits (50), Expect = 4.8 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = -1 Query: 651 VTLYKTCIRPRHDLCKCSVRSRGPH 577 +TL TC P D CK R PH Sbjct: 60 LTLTHTCNTPWADCCKVDEPGRVPH 84 >EF426180-1|ABO26423.1| 133|Anopheles gambiae unknown protein. Length = 133 Score = 24.2 bits (50), Expect = 4.8 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = -1 Query: 651 VTLYKTCIRPRHDLCKCSVRSRGPH 577 +TL TC P D CK R PH Sbjct: 60 LTLTHTCNTPWADCCKVDEPGRVPH 84 >EF426179-1|ABO26422.1| 133|Anopheles gambiae unknown protein. Length = 133 Score = 24.2 bits (50), Expect = 4.8 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = -1 Query: 651 VTLYKTCIRPRHDLCKCSVRSRGPH 577 +TL TC P D CK R PH Sbjct: 60 LTLTHTCNTPWADCCKVDEPGRVPH 84 >L04753-1|AAA29357.1| 511|Anopheles gambiae alpha-amylase protein. Length = 511 Score = 23.8 bits (49), Expect = 6.3 Identities = 19/68 (27%), Positives = 27/68 (39%), Gaps = 5/68 (7%) Frame = -1 Query: 270 SPFSSNPSLATKGSTSKLTLRHSPLSFSPDLLSGS--RFRSGGRFCEA---RLLLGFVLA 106 SP + N + + R+ P+SF D SGS F R C A RL + ++ Sbjct: 65 SPVNENIVIRLADGSRPWWERYQPISFKLDTRSGSEAEFADMSRRCNAAGVRLYVDIIIN 124 Query: 105 TSSGLSPV 82 PV Sbjct: 125 HMGATQPV 132 >EF426186-1|ABO26429.1| 133|Anopheles gambiae unknown protein. Length = 133 Score = 23.8 bits (49), Expect = 6.3 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = -1 Query: 648 TLYKTCIRPRHDLCKCSVRSRGPH 577 TL TC P D CK R PH Sbjct: 61 TLTHTCNTPWADCCKVDEPGRVPH 84 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 742,553 Number of Sequences: 2352 Number of extensions: 15321 Number of successful extensions: 45 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 42 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 45 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 84823812 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -