BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_T7_G13 (785 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_11396| Best HMM Match : Ribosomal_S2 (HMM E-Value=0) 133 2e-31 SB_24578| Best HMM Match : rve (HMM E-Value=4.8e-35) 36 0.028 SB_588| Best HMM Match : p450 (HMM E-Value=0.17) 33 0.26 SB_726| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_49472| Best HMM Match : BDS_I_II (HMM E-Value=1.5) 30 2.4 SB_4542| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 SB_50413| Best HMM Match : GRP (HMM E-Value=0.15) 28 7.5 SB_13671| Best HMM Match : RVT_1 (HMM E-Value=1.8e-11) 28 9.9 SB_4520| Best HMM Match : Tsg (HMM E-Value=7.8) 28 9.9 >SB_11396| Best HMM Match : Ribosomal_S2 (HMM E-Value=0) Length = 328 Score = 133 bits (321), Expect = 2e-31 Identities = 70/142 (49%), Positives = 88/142 (61%), Gaps = 4/142 (2%) Frame = -3 Query: 771 NPXXXXVIXSRPFGQXAVXKXPX----TPVXRLLRDVSHQVLLLTRSKLHSVNXVS*LYW 604 NP VI +RP+GQ A+ K TP+ + + + + V Sbjct: 70 NPADVCVISARPYGQRAILKYASHTGATPIAGRFTPGTFTNQIQAAFREPRLLIVC---- 125 Query: 603 TLQQDHQPITEASYVNIPVIALCNTDSPLRFVDIAIPCNTKSSHSIGLMWWLLAREVLRL 424 + DHQP+TEASYVNIPVIA CNTDSPLR VD+AIPCN K HSIGLM+WLLAREVLR+ Sbjct: 126 DPRIDHQPVTEASYVNIPVIAFCNTDSPLRHVDVAIPCNNKGIHSIGLMFWLLAREVLRM 185 Query: 423 RGVLPRDQRWDVVVDLFFYRXP 358 RG + R W+++ DL+FYR P Sbjct: 186 RGSISRALPWEIMPDLYFYRDP 207 Score = 68.5 bits (160), Expect = 6e-12 Identities = 31/35 (88%), Positives = 31/35 (88%) Frame = -2 Query: 703 HTGXTPIAGRFTPGAFTNQIQAAFREXRLLIVLDP 599 HTG TPIAGRFTPG FTNQIQAAFRE RLLIV DP Sbjct: 93 HTGATPIAGRFTPGTFTNQIQAAFREPRLLIVCDP 127 >SB_24578| Best HMM Match : rve (HMM E-Value=4.8e-35) Length = 1772 Score = 36.3 bits (80), Expect = 0.028 Identities = 24/67 (35%), Positives = 33/67 (49%), Gaps = 4/67 (5%) Frame = +2 Query: 377 KSTTTSQRWSRGSTPRSLSTSRANNHHIKPIEWEDLVLHGIAMST-NLSGE---SVLHKA 544 K+TT RWS+G TP ++ H I L+ HG ST NL+ E VL++ Sbjct: 1396 KTTTDKTRWSKGQTPNGKVAQKSKFQH--GIAGTQLIYHGTGPSTKNLTTEQAKQVLNEN 1453 Query: 545 ITGMLTY 565 G +TY Sbjct: 1454 ELGTMTY 1460 >SB_588| Best HMM Match : p450 (HMM E-Value=0.17) Length = 304 Score = 33.1 bits (72), Expect = 0.26 Identities = 17/58 (29%), Positives = 28/58 (48%) Frame = -3 Query: 708 PXTPVXRLLRDVSHQVLLLTRSKLHSVNXVS*LYWTLQQDHQPITEASYVNIPVIALC 535 P PV R S V + + +L +N + W + Q++ P+ Y +IP +ALC Sbjct: 40 PGPPVERFF---SGHVPIFNQGRLRGLNFYQ-ILWEISQEYSPVILLWYYHIPFVALC 93 >SB_726| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/66 (25%), Positives = 30/66 (45%), Gaps = 3/66 (4%) Frame = +2 Query: 365 R*KNKSTTTSQRWSRGSTPRSLSTSRANNHHIKPIEWEDL---VLHGIAMSTNLSGESVL 535 R N+ T ++ STP + + N+ ++P EW ++ H + L+GES Sbjct: 3 RGSNRRPTFKYKFGDSSTPFYSALKKQNDRSMRPWEWHEMKARYSHAQTLINALTGESKY 62 Query: 536 HKAITG 553 +TG Sbjct: 63 EFTLTG 68 >SB_49472| Best HMM Match : BDS_I_II (HMM E-Value=1.5) Length = 315 Score = 29.9 bits (64), Expect = 2.4 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -3 Query: 474 HSIGLMWWLLAREVLRLRGVLP 409 H G +WW+L E LR + VLP Sbjct: 46 HDDGSVWWVLTSESLRAKAVLP 67 >SB_4542| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 987 Score = 29.5 bits (63), Expect = 3.2 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = -3 Query: 198 SCFWSTPCSRRMVCPGTR*VEHNCRRTSRRHRSA 97 +C W+ P R+ PG R H T+R H +A Sbjct: 904 TCSWALPAHYRVHVPGQRSASHEAFDTTRPHENA 937 >SB_50413| Best HMM Match : GRP (HMM E-Value=0.15) Length = 487 Score = 28.3 bits (60), Expect = 7.5 Identities = 17/50 (34%), Positives = 24/50 (48%), Gaps = 1/50 (2%) Frame = +1 Query: 367 VEEQINHNIPALVTGKHTTKPQHFTCQQPPHQTNRVGR-LGVAWDSNVHK 513 V Q+ + P +T HT+ T P HQ + +GR G DSNV + Sbjct: 242 VTNQMRGHEPRSITYNHTSITAPLTTGYPDHQGSYMGRYAGSVADSNVSR 291 >SB_13671| Best HMM Match : RVT_1 (HMM E-Value=1.8e-11) Length = 1702 Score = 27.9 bits (59), Expect = 9.9 Identities = 17/44 (38%), Positives = 26/44 (59%) Frame = -3 Query: 528 DSPLRFVDIAIPCNTKSSHSIGLMWWLLAREVLRLRGVLPRDQR 397 +SPL + I +PCNT +S+ W+LLA + ++ VL D R Sbjct: 495 ESPLSYDLILVPCNTPNSNH----WFLLA-VLPHMKAVLLLDSR 533 >SB_4520| Best HMM Match : Tsg (HMM E-Value=7.8) Length = 594 Score = 27.9 bits (59), Expect = 9.9 Identities = 16/51 (31%), Positives = 25/51 (49%), Gaps = 4/51 (7%) Frame = +2 Query: 398 RWSRGSTPRSLSTSRA---NNHHIKPIEWE-DLVLHGIAMSTNLSGESVLH 538 RWS +TPR TS N H+ P+ + D+ H A + +L S ++ Sbjct: 62 RWSHATTPRGGGTSSVLALNLAHVPPVSGDYDVAFHKHAAAVHLEDWSTIN 112 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,796,780 Number of Sequences: 59808 Number of extensions: 404414 Number of successful extensions: 878 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 793 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 876 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2155861620 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -