BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_T7_G09 (797 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U40187-5|AAS80343.1| 1437|Caenorhabditis elegans Cytokinesis def... 33 0.31 U40187-4|AAS80342.1| 1435|Caenorhabditis elegans Cytokinesis def... 33 0.31 AF062008-1|AAC17501.1| 1018|Caenorhabditis elegans unknown protein. 33 0.31 AF025467-2|AAN65301.1| 505|Caenorhabditis elegans Hypothetical ... 33 0.31 AF025467-1|AAB71039.2| 528|Caenorhabditis elegans Hypothetical ... 33 0.31 AC024798-8|AAK29921.3| 1115|Caenorhabditis elegans Hypothetical ... 31 0.96 Z70312-3|CAA94385.1| 172|Caenorhabditis elegans Hypothetical pr... 30 1.7 AF535160-1|AAN33048.1| 468|Caenorhabditis elegans UNC-34 protein. 30 2.2 AC025722-6|AAO12398.1| 310|Caenorhabditis elegans Uncoordinated... 30 2.2 AC025722-5|AAO12397.1| 454|Caenorhabditis elegans Uncoordinated... 30 2.2 Z46676-8|CAB60993.2| 388|Caenorhabditis elegans Hypothetical pr... 29 2.9 U41538-2|AAG00010.1| 997|Caenorhabditis elegans Hypothetical pr... 29 2.9 U24189-3|AAC47514.1| 398|Caenorhabditis elegans RRM-type RNA bi... 29 2.9 U58751-5|AAN84882.1| 781|Caenorhabditis elegans Wasp (actin cyt... 29 5.1 U58751-4|AAN84881.1| 607|Caenorhabditis elegans Wasp (actin cyt... 29 5.1 AF003151-19|AAK18922.1| 988|Caenorhabditis elegans Hypothetical... 29 5.1 AF000298-11|AAM97960.1| 518|Caenorhabditis elegans Prion-like-(... 29 5.1 AF000298-10|AAM97961.1| 539|Caenorhabditis elegans Prion-like-(... 29 5.1 AF000298-8|AAC48255.2| 524|Caenorhabditis elegans Prion-like-(q... 29 5.1 Z79596-1|CAB01857.1| 830|Caenorhabditis elegans Hypothetical pr... 28 6.7 U80439-8|AAB37646.3| 1724|Caenorhabditis elegans Hypothetical pr... 28 6.7 U58736-1|AAB00598.1| 302|Caenorhabditis elegans Dumpy : shorter... 28 6.7 L29031-1|AAB72228.2| 830|Caenorhabditis elegans dynamin protein. 28 6.7 U39666-1|AAA80412.2| 644|Caenorhabditis elegans Nematode astaci... 28 8.9 >U40187-5|AAS80343.1| 1437|Caenorhabditis elegans Cytokinesis defect protein 1, isoformb protein. Length = 1437 Score = 32.7 bits (71), Expect = 0.31 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +3 Query: 510 PPPPXKKXGGGXPPFXPXPPXKXGGGXXXP 599 PPPP GG PP P PP GG P Sbjct: 758 PPPPPPPPGGCPPPPPPPPPGGFKGGPPPP 787 Score = 32.3 bits (70), Expect = 0.41 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 2/44 (4%) Frame = +3 Query: 510 PPPPXKKXGGGXPPFX--PXPPXKXGGGXXXPXXGPPXXKXXGG 635 PPPP GG PP P PP GG P PP GG Sbjct: 742 PPPPPPP--GGLPPISGGPPPPPPPPGGCPPPPPPPPPGGFKGG 783 Score = 30.3 bits (65), Expect = 1.7 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +3 Query: 489 PXXXXXXPPPPXKKXGGGXPPFXPXPPXKXGGGXXXPXXGPP 614 P PPPP GG PP P PP GG P PP Sbjct: 752 PPISGGPPPPPPPP--GGCPP--PPPPPPPGGFKGGPPPPPP 789 Score = 29.1 bits (62), Expect = 3.9 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = +3 Query: 489 PXXXXXXPPPPXKKXGGGXPPFXPXPPXKXGGGXXXPXXGPPXXKXXGGFFXPXGG 656 P PPPP G PP P PP GG GPP GG GG Sbjct: 707 PPITGGPPPPPGLPPITGGPP-PPPPP----GGLPPITGGPPPPPPPGGLPPISGG 757 Score = 28.7 bits (61), Expect = 5.1 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 2/44 (4%) Frame = +3 Query: 510 PPPPXKKXGGGXPPFX--PXPPXKXGGGXXXPXXGPPXXKXXGG 635 PPPP GG PP P PP GG PP GG Sbjct: 726 PPPPPPP--GGLPPITGGPPPPPPPGGLPPISGGPPPPPPPPGG 767 Score = 27.9 bits (59), Expect = 8.9 Identities = 22/68 (32%), Positives = 22/68 (32%) Frame = +1 Query: 412 PKXGGFFWXEGGPXXXXXKXPXXXXGPXXXXXXPPPXXKKXGGEXPLFXXXPPXKXGGXK 591 P GG GGP P G PPP GG P PP GG K Sbjct: 730 PPPGGLPPITGGPPP-----PPPPGGLPPISGGPPPPPPPPGGCPP---PPPPPPPGGFK 781 Query: 592 XTPXXGPP 615 P PP Sbjct: 782 GGPPPPPP 789 >U40187-4|AAS80342.1| 1435|Caenorhabditis elegans Cytokinesis defect protein 1, isoforma protein. Length = 1435 Score = 32.7 bits (71), Expect = 0.31 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +3 Query: 510 PPPPXKKXGGGXPPFXPXPPXKXGGGXXXP 599 PPPP GG PP P PP GG P Sbjct: 758 PPPPPPPPGGCPPPPPPPPPGGFKGGPPPP 787 Score = 32.3 bits (70), Expect = 0.41 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 2/44 (4%) Frame = +3 Query: 510 PPPPXKKXGGGXPPFX--PXPPXKXGGGXXXPXXGPPXXKXXGG 635 PPPP GG PP P PP GG P PP GG Sbjct: 742 PPPPPPP--GGLPPISGGPPPPPPPPGGCPPPPPPPPPGGFKGG 783 Score = 30.3 bits (65), Expect = 1.7 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +3 Query: 489 PXXXXXXPPPPXKKXGGGXPPFXPXPPXKXGGGXXXPXXGPP 614 P PPPP GG PP P PP GG P PP Sbjct: 752 PPISGGPPPPPPPP--GGCPP--PPPPPPPGGFKGGPPPPPP 789 Score = 29.1 bits (62), Expect = 3.9 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = +3 Query: 489 PXXXXXXPPPPXKKXGGGXPPFXPXPPXKXGGGXXXPXXGPPXXKXXGGFFXPXGG 656 P PPPP G PP P PP GG GPP GG GG Sbjct: 707 PPITGGPPPPPGLPPITGGPP-PPPPP----GGLPPITGGPPPPPPPGGLPPISGG 757 Score = 28.7 bits (61), Expect = 5.1 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 2/44 (4%) Frame = +3 Query: 510 PPPPXKKXGGGXPPFX--PXPPXKXGGGXXXPXXGPPXXKXXGG 635 PPPP GG PP P PP GG PP GG Sbjct: 726 PPPPPPP--GGLPPITGGPPPPPPPGGLPPISGGPPPPPPPPGG 767 Score = 27.9 bits (59), Expect = 8.9 Identities = 22/68 (32%), Positives = 22/68 (32%) Frame = +1 Query: 412 PKXGGFFWXEGGPXXXXXKXPXXXXGPXXXXXXPPPXXKKXGGEXPLFXXXPPXKXGGXK 591 P GG GGP P G PPP GG P PP GG K Sbjct: 730 PPPGGLPPITGGPPP-----PPPPGGLPPISGGPPPPPPPPGGCPP---PPPPPPPGGFK 781 Query: 592 XTPXXGPP 615 P PP Sbjct: 782 GGPPPPPP 789 >AF062008-1|AAC17501.1| 1018|Caenorhabditis elegans unknown protein. Length = 1018 Score = 32.7 bits (71), Expect = 0.31 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +3 Query: 510 PPPPXKKXGGGXPPFXPXPPXKXGGGXXXP 599 PPPP GG PP P PP GG P Sbjct: 341 PPPPPPPPGGCPPPPPPPPPGGFKGGPPPP 370 Score = 32.3 bits (70), Expect = 0.41 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 2/44 (4%) Frame = +3 Query: 510 PPPPXKKXGGGXPPFX--PXPPXKXGGGXXXPXXGPPXXKXXGG 635 PPPP GG PP P PP GG P PP GG Sbjct: 325 PPPPPPP--GGLPPISGGPPPPPPPPGGCPPPPPPPPPGGFKGG 366 Score = 30.3 bits (65), Expect = 1.7 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +3 Query: 489 PXXXXXXPPPPXKKXGGGXPPFXPXPPXKXGGGXXXPXXGPP 614 P PPPP GG PP P PP GG P PP Sbjct: 335 PPISGGPPPPPPPP--GGCPP--PPPPPPPGGFKGGPPPPPP 372 Score = 29.1 bits (62), Expect = 3.9 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = +3 Query: 489 PXXXXXXPPPPXKKXGGGXPPFXPXPPXKXGGGXXXPXXGPPXXKXXGGFFXPXGG 656 P PPPP G PP P PP GG GPP GG GG Sbjct: 290 PPITGGPPPPPGLPPITGGPP-PPPPP----GGLPPITGGPPPPPPPGGLPPISGG 340 Score = 28.7 bits (61), Expect = 5.1 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 2/44 (4%) Frame = +3 Query: 510 PPPPXKKXGGGXPPFX--PXPPXKXGGGXXXPXXGPPXXKXXGG 635 PPPP GG PP P PP GG PP GG Sbjct: 309 PPPPPPP--GGLPPITGGPPPPPPPGGLPPISGGPPPPPPPPGG 350 Score = 27.9 bits (59), Expect = 8.9 Identities = 22/68 (32%), Positives = 22/68 (32%) Frame = +1 Query: 412 PKXGGFFWXEGGPXXXXXKXPXXXXGPXXXXXXPPPXXKKXGGEXPLFXXXPPXKXGGXK 591 P GG GGP P G PPP GG P PP GG K Sbjct: 313 PPPGGLPPITGGPPP-----PPPPGGLPPISGGPPPPPPPPGGCPP---PPPPPPPGGFK 364 Query: 592 XTPXXGPP 615 P PP Sbjct: 365 GGPPPPPP 372 >AF025467-2|AAN65301.1| 505|Caenorhabditis elegans Hypothetical protein R148.5b protein. Length = 505 Score = 32.7 bits (71), Expect = 0.31 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +3 Query: 486 GPXXXXXXPPPPXKKXGGGXPPFXPXPPXKXGGGXXXPXXGPP 614 GP PP P GG PPF P PP P G P Sbjct: 330 GPPRGFMPPPHPMMFRGGPYPPFFPPPPPHFMRPSSPPTDGGP 372 Score = 29.9 bits (64), Expect = 2.2 Identities = 18/54 (33%), Positives = 19/54 (35%), Gaps = 1/54 (1%) Frame = +3 Query: 489 PXXXXXXPPPPXKKXGGGXPPFXPXPPXKXGGGXXXPXXGPP-XXKXXGGFFXP 647 P PPPP G G PP PP G G PP GG + P Sbjct: 298 PPPRGHFPPPPPHFMGRGMPPPFMPPPPHFGMGPPRGFMPPPHPMMFRGGPYPP 351 Score = 29.9 bits (64), Expect = 2.2 Identities = 19/69 (27%), Positives = 19/69 (27%) Frame = +1 Query: 409 FPKXGGFFWXEGGPXXXXXKXPXXXXGPXXXXXXPPPXXKKXGGEXPLFXXXPPXKXGGX 588 FP F G P P GP PP GG P F PP Sbjct: 304 FPPPPPHFMGRGMPPPFMPPPPHFGMGPPRGFMPPPHPMMFRGGPYPPFFPPPPPHFMRP 363 Query: 589 KXTPXXGPP 615 P G P Sbjct: 364 SSPPTDGGP 372 >AF025467-1|AAB71039.2| 528|Caenorhabditis elegans Hypothetical protein R148.5a protein. Length = 528 Score = 32.7 bits (71), Expect = 0.31 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +3 Query: 486 GPXXXXXXPPPPXKKXGGGXPPFXPXPPXKXGGGXXXPXXGPP 614 GP PP P GG PPF P PP P G P Sbjct: 330 GPPRGFMPPPHPMMFRGGPYPPFFPPPPPHFMRPSSPPTDGGP 372 Score = 29.9 bits (64), Expect = 2.2 Identities = 18/54 (33%), Positives = 19/54 (35%), Gaps = 1/54 (1%) Frame = +3 Query: 489 PXXXXXXPPPPXKKXGGGXPPFXPXPPXKXGGGXXXPXXGPP-XXKXXGGFFXP 647 P PPPP G G PP PP G G PP GG + P Sbjct: 298 PPPRGHFPPPPPHFMGRGMPPPFMPPPPHFGMGPPRGFMPPPHPMMFRGGPYPP 351 Score = 29.9 bits (64), Expect = 2.2 Identities = 19/69 (27%), Positives = 19/69 (27%) Frame = +1 Query: 409 FPKXGGFFWXEGGPXXXXXKXPXXXXGPXXXXXXPPPXXKKXGGEXPLFXXXPPXKXGGX 588 FP F G P P GP PP GG P F PP Sbjct: 304 FPPPPPHFMGRGMPPPFMPPPPHFGMGPPRGFMPPPHPMMFRGGPYPPFFPPPPPHFMRP 363 Query: 589 KXTPXXGPP 615 P G P Sbjct: 364 SSPPTDGGP 372 >AC024798-8|AAK29921.3| 1115|Caenorhabditis elegans Hypothetical protein Y48G9A.4 protein. Length = 1115 Score = 31.1 bits (67), Expect = 0.96 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +3 Query: 510 PPPPXKKXGGGXPPFXPXPPXKXGGGXXXP 599 PPPP + G PP P PP GG P Sbjct: 564 PPPPLPQNLSGAPPPPPPPPPMLGGPPPPP 593 >Z70312-3|CAA94385.1| 172|Caenorhabditis elegans Hypothetical protein ZC168.5 protein. Length = 172 Score = 30.3 bits (65), Expect = 1.7 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +3 Query: 489 PXXXXXXPPPPXKKXGGGXPPFXPXPPXKXGGG 587 P PPPP GGG P PP GG Sbjct: 33 PQQCCCPPPPPPPPCGGGYEAPPPPPPPSYAGG 65 >AF535160-1|AAN33048.1| 468|Caenorhabditis elegans UNC-34 protein. Length = 468 Score = 29.9 bits (64), Expect = 2.2 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 510 PPPPXKKXGGGXPPFXPXPP 569 PPPP G G PP P PP Sbjct: 235 PPPPLPPVGAGAPPPPPPPP 254 >AC025722-6|AAO12398.1| 310|Caenorhabditis elegans Uncoordinated protein 34, isoform b protein. Length = 310 Score = 29.9 bits (64), Expect = 2.2 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 510 PPPPXKKXGGGXPPFXPXPP 569 PPPP G G PP P PP Sbjct: 221 PPPPLPPVGAGAPPPPPPPP 240 >AC025722-5|AAO12397.1| 454|Caenorhabditis elegans Uncoordinated protein 34, isoform a protein. Length = 454 Score = 29.9 bits (64), Expect = 2.2 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 510 PPPPXKKXGGGXPPFXPXPP 569 PPPP G G PP P PP Sbjct: 221 PPPPLPPVGAGAPPPPPPPP 240 >Z46676-8|CAB60993.2| 388|Caenorhabditis elegans Hypothetical protein C08B11.5 protein. Length = 388 Score = 29.5 bits (63), Expect = 2.9 Identities = 14/42 (33%), Positives = 15/42 (35%) Frame = +3 Query: 489 PXXXXXXPPPPXKKXGGGXPPFXPXPPXKXGGGXXXPXXGPP 614 P P PP G PP P PP + G P PP Sbjct: 278 PPTPGMTPRPPPPPSSGMWPPPPPPPPGRTPGPPGMPGMPPP 319 Score = 29.5 bits (63), Expect = 2.9 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +3 Query: 510 PPPPXKKXGGGXPPFXPXPPXKXGGGXXXPXXGPP 614 PPPP + GG PP P PP G PP Sbjct: 336 PPPPGMRYPGGMPP--PPPPRYPSAGPGMYPPPPP 368 Score = 29.1 bits (62), Expect = 3.9 Identities = 19/52 (36%), Positives = 22/52 (42%), Gaps = 6/52 (11%) Frame = +3 Query: 510 PPPPXKKXG----GGXPPFXPXPPXKXG--GGXXXPXXGPPXXKXXGGFFXP 647 PPPP + G G PP P PP + G G P PP + GG P Sbjct: 301 PPPPGRTPGPPGMPGMPP--PPPPSRFGPPGMGGMPPPPPPGMRYPGGMPPP 350 Score = 29.1 bits (62), Expect = 3.9 Identities = 18/57 (31%), Positives = 20/57 (35%), Gaps = 4/57 (7%) Frame = +3 Query: 489 PXXXXXXPPPPXKKXG----GGXPPFXPXPPXKXGGGXXXPXXGPPXXKXXGGFFXP 647 P PPPP + G GG PP P PP G P P G + P Sbjct: 311 PGMPGMPPPPPPSRFGPPGMGGMPP--PPPPGMRYPGGMPPPPPPRYPSAGPGMYPP 365 >U41538-2|AAG00010.1| 997|Caenorhabditis elegans Hypothetical protein R04E5.8a protein. Length = 997 Score = 29.5 bits (63), Expect = 2.9 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 510 PPPPXKKXGGGXPPFXPXPP 569 PPPP K GG P P PP Sbjct: 125 PPPPRKSRAGGSSPPPPPPP 144 >U24189-3|AAC47514.1| 398|Caenorhabditis elegans RRM-type RNA binding protein protein. Length = 398 Score = 29.5 bits (63), Expect = 2.9 Identities = 14/42 (33%), Positives = 15/42 (35%) Frame = +3 Query: 489 PXXXXXXPPPPXKKXGGGXPPFXPXPPXKXGGGXXXPXXGPP 614 P P PP G PP P PP + G P PP Sbjct: 288 PPTPGMTPRPPPPPSSGMWPPPPPPPPGRTPGPPGMPGMPPP 329 Score = 29.5 bits (63), Expect = 2.9 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +3 Query: 510 PPPPXKKXGGGXPPFXPXPPXKXGGGXXXPXXGPP 614 PPPP + GG PP P PP G PP Sbjct: 346 PPPPGMRYPGGMPP--PPPPRYPSAGPGMYPPPPP 378 Score = 29.1 bits (62), Expect = 3.9 Identities = 19/52 (36%), Positives = 22/52 (42%), Gaps = 6/52 (11%) Frame = +3 Query: 510 PPPPXKKXG----GGXPPFXPXPPXKXG--GGXXXPXXGPPXXKXXGGFFXP 647 PPPP + G G PP P PP + G G P PP + GG P Sbjct: 311 PPPPGRTPGPPGMPGMPP--PPPPSRFGPPGMGGMPPPPPPGMRYPGGMPPP 360 Score = 29.1 bits (62), Expect = 3.9 Identities = 18/57 (31%), Positives = 20/57 (35%), Gaps = 4/57 (7%) Frame = +3 Query: 489 PXXXXXXPPPPXKKXG----GGXPPFXPXPPXKXGGGXXXPXXGPPXXKXXGGFFXP 647 P PPPP + G GG PP P PP G P P G + P Sbjct: 321 PGMPGMPPPPPPSRFGPPGMGGMPP--PPPPGMRYPGGMPPPPPPRYPSAGPGMYPP 375 >U58751-5|AAN84882.1| 781|Caenorhabditis elegans Wasp (actin cytoskeleton modulator)homolog protein 1, isoform b protein. Length = 781 Score = 28.7 bits (61), Expect = 5.1 Identities = 13/28 (46%), Positives = 13/28 (46%), Gaps = 2/28 (7%) Frame = +3 Query: 510 PPPPX--KKXGGGXPPFXPXPPXKXGGG 587 PPPP G G PP P PP GG Sbjct: 635 PPPPMGLPAVGAGAPPPPPPPPPSGAGG 662 >U58751-4|AAN84881.1| 607|Caenorhabditis elegans Wasp (actin cytoskeleton modulator)homolog protein 1, isoform a protein. Length = 607 Score = 28.7 bits (61), Expect = 5.1 Identities = 13/28 (46%), Positives = 13/28 (46%), Gaps = 2/28 (7%) Frame = +3 Query: 510 PPPPX--KKXGGGXPPFXPXPPXKXGGG 587 PPPP G G PP P PP GG Sbjct: 461 PPPPMGLPAVGAGAPPPPPPPPPSGAGG 488 >AF003151-19|AAK18922.1| 988|Caenorhabditis elegans Hypothetical protein D1007.7 protein. Length = 988 Score = 28.7 bits (61), Expect = 5.1 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = +3 Query: 510 PPPPXKKXGGGXPPFXP 560 PPP + GGG PPF P Sbjct: 798 PPPHFDRRGGGGPPFRP 814 Score = 28.3 bits (60), Expect = 6.7 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = -1 Query: 584 PPXFXGGXXXKRGXSPPXFFXXGGG 510 PP F GG G PP F GGG Sbjct: 784 PPSFRGGRGGHGGPPPPHFDRRGGG 808 >AF000298-11|AAM97960.1| 518|Caenorhabditis elegans Prion-like-(q/n-rich)-domain-bearingprotein protein 75, isoform b protein. Length = 518 Score = 28.7 bits (61), Expect = 5.1 Identities = 12/34 (35%), Positives = 13/34 (38%) Frame = +3 Query: 513 PPPXKKXGGGXPPFXPXPPXKXGGGXXXPXXGPP 614 PPP + PP PP GG P G P Sbjct: 264 PPPPRTGSPPPPPTGSPPPPPAGGSPPPPRAGSP 297 Score = 27.9 bits (59), Expect = 8.9 Identities = 14/42 (33%), Positives = 16/42 (38%) Frame = +3 Query: 489 PXXXXXXPPPPXKKXGGGXPPFXPXPPXKXGGGXXXPXXGPP 614 P PPPP + G PP PP + GG G P Sbjct: 291 PPRAGSPPPPPPPR---GSPPTGSLPPPQAGGSPPPAGTGSP 329 >AF000298-10|AAM97961.1| 539|Caenorhabditis elegans Prion-like-(q/n-rich)-domain-bearingprotein protein 75, isoform c protein. Length = 539 Score = 28.7 bits (61), Expect = 5.1 Identities = 12/34 (35%), Positives = 13/34 (38%) Frame = +3 Query: 513 PPPXKKXGGGXPPFXPXPPXKXGGGXXXPXXGPP 614 PPP + PP PP GG P G P Sbjct: 285 PPPPRTGSPPPPPTGSPPPPPAGGSPPPPRAGSP 318 Score = 27.9 bits (59), Expect = 8.9 Identities = 14/42 (33%), Positives = 16/42 (38%) Frame = +3 Query: 489 PXXXXXXPPPPXKKXGGGXPPFXPXPPXKXGGGXXXPXXGPP 614 P PPPP + G PP PP + GG G P Sbjct: 312 PPRAGSPPPPPPPR---GSPPTGSLPPPQAGGSPPPAGTGSP 350 >AF000298-8|AAC48255.2| 524|Caenorhabditis elegans Prion-like-(q/n-rich)-domain-bearingprotein protein 75, isoform a protein. Length = 524 Score = 28.7 bits (61), Expect = 5.1 Identities = 12/34 (35%), Positives = 13/34 (38%) Frame = +3 Query: 513 PPPXKKXGGGXPPFXPXPPXKXGGGXXXPXXGPP 614 PPP + PP PP GG P G P Sbjct: 270 PPPPRTGSPPPPPTGSPPPPPAGGSPPPPRAGSP 303 Score = 27.9 bits (59), Expect = 8.9 Identities = 14/42 (33%), Positives = 16/42 (38%) Frame = +3 Query: 489 PXXXXXXPPPPXKKXGGGXPPFXPXPPXKXGGGXXXPXXGPP 614 P PPPP + G PP PP + GG G P Sbjct: 297 PPRAGSPPPPPPPR---GSPPTGSLPPPQAGGSPPPAGTGSP 335 >Z79596-1|CAB01857.1| 830|Caenorhabditis elegans Hypothetical protein C02C6.1a protein. Length = 830 Score = 28.3 bits (60), Expect = 6.7 Identities = 12/33 (36%), Positives = 14/33 (42%) Frame = +3 Query: 516 PPXKKXGGGXPPFXPXPPXKXGGGXXXPXXGPP 614 PP GGG + P P + G G P PP Sbjct: 797 PPPGAPGGGGGMYPPLIPTRPGPGGPPPNMAPP 829 >U80439-8|AAB37646.3| 1724|Caenorhabditis elegans Hypothetical protein C01G8.9a protein. Length = 1724 Score = 28.3 bits (60), Expect = 6.7 Identities = 18/56 (32%), Positives = 20/56 (35%), Gaps = 1/56 (1%) Frame = +3 Query: 489 PXXXXXXPPPPXKKXGGGXPPFXPXPPXKXGGGXXXPXXGPP-XXKXXGGFFXPXG 653 P PP P + G PP P P G P GPP + GF P G Sbjct: 700 PPPTSVQPPQPQQPPQG--PPGPPGPQQHPGPYPGYPGYGPPGAMRPPAGFAPPPG 753 >U58736-1|AAB00598.1| 302|Caenorhabditis elegans Dumpy : shorter than wild-typeprotein 3 protein. Length = 302 Score = 28.3 bits (60), Expect = 6.7 Identities = 17/50 (34%), Positives = 19/50 (38%), Gaps = 2/50 (4%) Frame = +3 Query: 510 PPPPXKKXGGGXP--PFXPXPPXKXGGGXXXPXXGPPXXKXXGGFFXPXG 653 P PP + G P P P PP + G P PP K G P G Sbjct: 116 PGPPGRDGRPGAPGRPGNPGPPGRDGALLPGPPPKPPCQKCPPGPPGPAG 165 Score = 27.9 bits (59), Expect = 8.9 Identities = 19/52 (36%), Positives = 19/52 (36%), Gaps = 3/52 (5%) Frame = +3 Query: 510 PPPPXKKXGGGXPPFXPXPPXKXGG-GXXXPXX--GPPXXKXXGGFFXPXGG 656 PP P G P P PP K G G P G P K G P GG Sbjct: 223 PPGPPGPPGPPGPQGPPGPPGKDGQPGKAGPPGLPGDPGEKGSDGLPGPHGG 274 >L29031-1|AAB72228.2| 830|Caenorhabditis elegans dynamin protein. Length = 830 Score = 28.3 bits (60), Expect = 6.7 Identities = 12/33 (36%), Positives = 14/33 (42%) Frame = +3 Query: 516 PPXKKXGGGXPPFXPXPPXKXGGGXXXPXXGPP 614 PP GGG + P P + G G P PP Sbjct: 797 PPPGAPGGGGGMYPPLIPTRPGPGGPPPNMAPP 829 >U39666-1|AAA80412.2| 644|Caenorhabditis elegans Nematode astacin protease protein33 protein. Length = 644 Score = 27.9 bits (59), Expect = 8.9 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +3 Query: 510 PPPPXKKXGGGXPPFXPXPP 569 PPPP + G PPF P PP Sbjct: 40 PPPPWHR-NRGPPPFGPPPP 58 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,888,186 Number of Sequences: 27780 Number of extensions: 245997 Number of successful extensions: 925 Number of sequences better than 10.0: 24 Number of HSP's better than 10.0 without gapping: 509 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 796 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1945792630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -