BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_T7_G08 (800 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g18830.2 68418.m02238 squamosa promoter-binding protein-like ... 30 1.6 At3g44800.1 68416.m04826 meprin and TRAF homology domain-contain... 30 1.6 At3g53440.2 68416.m05898 expressed protein 30 2.1 At3g53440.1 68416.m05897 expressed protein 30 2.1 At5g51710.1 68418.m06413 K+ efflux antiporter, putative (KEA5) M... 29 3.6 At5g41150.1 68418.m05002 repair endonuclease (RAD1) (UVH1) conta... 29 3.6 At2g19600.1 68415.m02289 K+ efflux antiporter, putative (KEA4) s... 29 3.6 At5g65770.1 68418.m08276 nuclear matrix constituent protein-rela... 29 4.7 At5g11800.1 68418.m01377 K+ efflux antiporter, putative (KEA6) M... 28 6.3 At1g64340.1 68414.m07291 hypothetical protein 28 8.3 >At5g18830.2 68418.m02238 squamosa promoter-binding protein-like 7 (SPL7) identical to squamosa promoter binding protein-like 7 [Arabidopsis thaliana] GI:5931635; contains Pfam profile PF03110: SBP domain Length = 775 Score = 30.3 bits (65), Expect = 1.6 Identities = 18/68 (26%), Positives = 31/68 (45%), Gaps = 1/68 (1%) Frame = -2 Query: 526 TVVRQVSFTLLMACRCDSNTAQYERNRSFGHLVHALGRAAGGAKLPSAGL-CLNASKAEA 350 T+V+++ L+ C CD + N +H ++ +K P AGL C +A+ Sbjct: 632 TLVKKMEPDSLVHCTCDCDVRLLHENMDLASDIHRKHQSPIESKDPEAGLDCKERIQADC 691 Query: 349 SLAESGKD 326 S GK+ Sbjct: 692 SPDSGGKE 699 >At3g44800.1 68416.m04826 meprin and TRAF homology domain-containing protein / MATH domain-containing protein Length = 564 Score = 30.3 bits (65), Expect = 1.6 Identities = 18/58 (31%), Positives = 30/58 (51%) Frame = +3 Query: 111 KSSTDYSEPRHRTELYPDLRSRDARVKKKTDSIDLRDPNGLRRRVSRFECETRLVKSH 284 K S + +PR R LY D + + + K+T S+D+ NG + S+ E R+ + H Sbjct: 142 KESQEVIKPRKRMRLYGDGGAVSSHLHKETSSVDV---NGFQVLPSQAESVKRIFERH 196 >At3g53440.2 68416.m05898 expressed protein Length = 512 Score = 29.9 bits (64), Expect = 2.1 Identities = 23/74 (31%), Positives = 34/74 (45%) Frame = +3 Query: 108 RKSSTDYSEPRHRTELYPDLRSRDARVKKKTDSIDLRDPNGLRRRVSRFECETRLVKSHC 287 RKS+ +P R+ L++RD++VK + D +P RR RLV S Sbjct: 4 RKSTVVLPQPIRRSARLISLQNRDSQVKPRKDLGFGSEPTKKTRREVLRGLSKRLVYSSD 63 Query: 288 LEPPDSRGSTVSIS 329 DSR ++IS Sbjct: 64 SPIEDSRSKKLNIS 77 >At3g53440.1 68416.m05897 expressed protein Length = 512 Score = 29.9 bits (64), Expect = 2.1 Identities = 23/74 (31%), Positives = 34/74 (45%) Frame = +3 Query: 108 RKSSTDYSEPRHRTELYPDLRSRDARVKKKTDSIDLRDPNGLRRRVSRFECETRLVKSHC 287 RKS+ +P R+ L++RD++VK + D +P RR RLV S Sbjct: 4 RKSTVVLPQPIRRSARLISLQNRDSQVKPRKDLGFGSEPTKKTRREVLRGLSKRLVYSSD 63 Query: 288 LEPPDSRGSTVSIS 329 DSR ++IS Sbjct: 64 SPIEDSRSKKLNIS 77 >At5g51710.1 68418.m06413 K+ efflux antiporter, putative (KEA5) Monovalent cation:proton antiporter family 2 (CPA2 family) member, PMID:11500563; related to glutathione-regulated potassium-efflux system protein [Escherichia coli] GP|606284|gb|AAA58147 Length = 568 Score = 29.1 bits (62), Expect = 3.6 Identities = 14/37 (37%), Positives = 21/37 (56%) Frame = +2 Query: 572 LGEFCFAMIGRADIEXIKKQRRYERLAATSQLSLVVT 682 +GEF F ++ RA + + + Y L T+ LSLV T Sbjct: 487 IGEFAFVLLSRASNLHVIEGKMYLLLLGTTALSLVTT 523 >At5g41150.1 68418.m05002 repair endonuclease (RAD1) (UVH1) contains Pfam PF02732 : ERCC4 domain; contains TIGRFAM TIGR00596: DNA repair protein (rad1); almost identical to 5' repair endonuclease (GI:8926611) [Arabidopsis thaliana] Length = 956 Score = 29.1 bits (62), Expect = 3.6 Identities = 25/102 (24%), Positives = 43/102 (42%), Gaps = 2/102 (1%) Frame = +3 Query: 45 GLSLNRSQHDAALPSTTPRQERKSSTDYSEPRHRTELYPDLRSRDARVKKKTDSIDLRDP 224 G S+ R +H+A + + + ++ +TD + + E + D S KK DP Sbjct: 492 GSSVGRQEHEALMAAASSIRKLGKTTDMASGNNNPEPHVDKASCTKGKAKK-------DP 544 Query: 225 NGLRRRVSRFECETRLVKSHCLEPPDS--RGSTVSISLPDSA 344 LRR + +T K L P++ + + S S P A Sbjct: 545 TSLRRSLRSCNKKTTNSKPEILPGPENEEKANEASTSAPQEA 586 >At2g19600.1 68415.m02289 K+ efflux antiporter, putative (KEA4) similar to glutathione-regulated potassium-efflux system protein KEFB, Escherichia coli, SWISSPROT:P45522; Monovalent cation:proton antiporter family 2 (CPA2 family) member, PMID:11500563; Note: non-consensus splice site (GC) in intron 14 Length = 592 Score = 29.1 bits (62), Expect = 3.6 Identities = 14/37 (37%), Positives = 21/37 (56%) Frame = +2 Query: 572 LGEFCFAMIGRADIEXIKKQRRYERLAATSQLSLVVT 682 +GEF F ++ RA + + + Y L T+ LSLV T Sbjct: 502 IGEFAFVLLSRASNLHLIESKLYLLLLGTTALSLVTT 538 >At5g65770.1 68418.m08276 nuclear matrix constituent protein-related low similarity to nuclear matrix constituent protein 1 (NMCP1) [Daucus carota] GI:2190187 Length = 1042 Score = 28.7 bits (61), Expect = 4.7 Identities = 22/74 (29%), Positives = 36/74 (48%) Frame = +3 Query: 102 QERKSSTDYSEPRHRTELYPDLRSRDARVKKKTDSIDLRDPNGLRRRVSRFECETRLVKS 281 +E K+S D S+ H E + S A KK+ +S+ +D + +S E +++ Sbjct: 95 EEIKASVDESDLTHMREKSAYV-SALAEAKKREESLK-KDVGIAKECISSLEKTLHEMRA 152 Query: 282 HCLEPPDSRGSTVS 323 C E S GST+S Sbjct: 153 ECAETKVSAGSTMS 166 >At5g11800.1 68418.m01377 K+ efflux antiporter, putative (KEA6) Monovalent cation:proton antiporter family 2 (CPA2 family) member, PMID:11500563; similar to glutathione-regulated potassium-efflux system protein KEFB, Escherichia coli, SWISSPROT:P45522 Length = 597 Score = 28.3 bits (60), Expect = 6.3 Identities = 14/37 (37%), Positives = 21/37 (56%) Frame = +2 Query: 572 LGEFCFAMIGRADIEXIKKQRRYERLAATSQLSLVVT 682 +GEF F ++ RA + + + Y L T+ LSLV T Sbjct: 510 IGEFAFVLLSRASNLHLIEGKLYLLLLGTTALSLVTT 546 >At1g64340.1 68414.m07291 hypothetical protein Length = 265 Score = 27.9 bits (59), Expect = 8.3 Identities = 12/37 (32%), Positives = 19/37 (51%) Frame = -1 Query: 746 DCESTAYRSFSIKSF*QEVPEKLPPGITGLWQPSVHS 636 DCEST Y SF + SF +++ + + P + S Sbjct: 124 DCESTLYDSFELNSFNRQLNSAISSSARSMSMPHLSS 160 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,324,185 Number of Sequences: 28952 Number of extensions: 364827 Number of successful extensions: 915 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 895 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 915 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1814318400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -