BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_T7_G04 (798 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 23 2.8 AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax pr... 23 2.8 AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax pr... 23 2.8 AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax pr... 23 2.8 AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax pr... 23 2.8 AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. 23 2.8 AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax pr... 23 2.8 AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduce... 23 2.8 AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 22 6.5 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 22 6.5 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 23.0 bits (47), Expect = 2.8 Identities = 12/29 (41%), Positives = 15/29 (51%), Gaps = 2/29 (6%) Frame = +1 Query: 385 PPCAASPPDQQPSTGHPRHP--APDSPYG 465 PP SPP P +P+HP AP +G Sbjct: 39 PPACYSPPQVAPQ--YPQHPYAAPAPGHG 65 >AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 23.0 bits (47), Expect = 2.8 Identities = 12/29 (41%), Positives = 15/29 (51%), Gaps = 2/29 (6%) Frame = +1 Query: 385 PPCAASPPDQQPSTGHPRHP--APDSPYG 465 PP SPP P +P+HP AP +G Sbjct: 39 PPACYSPPQVAPQ--YPQHPYAAPAPGHG 65 >AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax protein. Length = 230 Score = 23.0 bits (47), Expect = 2.8 Identities = 12/29 (41%), Positives = 15/29 (51%), Gaps = 2/29 (6%) Frame = +1 Query: 385 PPCAASPPDQQPSTGHPRHP--APDSPYG 465 PP SPP P +P+HP AP +G Sbjct: 39 PPACYSPPQVAPQ--YPQHPYAAPAPGHG 65 >AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 23.0 bits (47), Expect = 2.8 Identities = 12/29 (41%), Positives = 15/29 (51%), Gaps = 2/29 (6%) Frame = +1 Query: 385 PPCAASPPDQQPSTGHPRHP--APDSPYG 465 PP SPP P +P+HP AP +G Sbjct: 39 PPACYSPPQVAPQ--YPQHPYAAPAPGHG 65 >AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax protein. Length = 297 Score = 23.0 bits (47), Expect = 2.8 Identities = 12/29 (41%), Positives = 15/29 (51%), Gaps = 2/29 (6%) Frame = +1 Query: 385 PPCAASPPDQQPSTGHPRHP--APDSPYG 465 PP SPP P +P+HP AP +G Sbjct: 39 PPACYSPPQVAPQ--YPQHPYAAPAPGHG 65 >AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. Length = 312 Score = 23.0 bits (47), Expect = 2.8 Identities = 12/29 (41%), Positives = 15/29 (51%), Gaps = 2/29 (6%) Frame = +1 Query: 385 PPCAASPPDQQPSTGHPRHP--APDSPYG 465 PP SPP P +P+HP AP +G Sbjct: 39 PPACYSPPQVAPQ--YPQHPYAAPAPGHG 65 >AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax protein. Length = 157 Score = 23.0 bits (47), Expect = 2.8 Identities = 12/29 (41%), Positives = 15/29 (51%), Gaps = 2/29 (6%) Frame = +1 Query: 385 PPCAASPPDQQPSTGHPRHP--APDSPYG 465 PP SPP P +P+HP AP +G Sbjct: 39 PPACYSPPQVAPQ--YPQHPYAAPAPGHG 65 >AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduced Scr protein. Length = 312 Score = 23.0 bits (47), Expect = 2.8 Identities = 12/29 (41%), Positives = 15/29 (51%), Gaps = 2/29 (6%) Frame = +1 Query: 385 PPCAASPPDQQPSTGHPRHP--APDSPYG 465 PP SPP P +P+HP AP +G Sbjct: 39 PPACYSPPQVAPQ--YPQHPYAAPAPGHG 65 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 21.8 bits (44), Expect = 6.5 Identities = 12/42 (28%), Positives = 21/42 (50%) Frame = -2 Query: 332 PGDGVPSY*QDGYRRRRAFGAHCAVXVGFVESEWWGSMGFSR 207 PG +P + +G + AH + ++S+ GSMG +R Sbjct: 120 PGAALPFFCHNGDPLSQPPPAHMGIPPYQLDSKTAGSMGLTR 161 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 21.8 bits (44), Expect = 6.5 Identities = 12/42 (28%), Positives = 21/42 (50%) Frame = -2 Query: 332 PGDGVPSY*QDGYRRRRAFGAHCAVXVGFVESEWWGSMGFSR 207 PG +P + +G + AH + ++S+ GSMG +R Sbjct: 12 PGAALPFFCHNGDPLSQPPPAHMGIPPYQLDSKTAGSMGLTR 53 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 188,393 Number of Sequences: 336 Number of extensions: 4445 Number of successful extensions: 22 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21687721 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -