BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_T7_F22 (805 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_01_0110 + 850780-850805,851465-851537,851558-851720,851947-85... 29 3.3 06_01_0196 + 1520015-1520191,1520483-1520527,1521851-1521910,152... 29 4.3 03_03_0042 + 14009649-14009866,14011342-14011419,14011791-140119... 29 4.3 11_01_0022 + 151233-151515,152632-152852,153579-153656,154558-15... 29 5.7 10_05_0012 + 7874326-7874831,7929715-7931393,7931508-7933396 29 5.7 03_06_0233 + 32530174-32530492,32531081-32531127,32531277-325314... 29 5.7 02_02_0537 + 11308195-11309667 29 5.7 01_05_0645 - 23899579-23904483 29 5.7 10_08_0898 + 21424379-21424792,21424974-21425723 28 7.6 04_04_1093 + 30825722-30826168,30826457-30826608,30826926-308270... 28 7.6 01_01_0060 + 477667-477816,479312-479722 28 7.6 >11_01_0110 + 850780-850805,851465-851537,851558-851720,851947-852260, 852330-852409,852506-852848,853068-853166,853240-853360, 853567-853723,853976-854099,855275-855368,855866-857259, 857882-857924,858240-858458,859379-859605,859701-859948, 860246-860552,860725-861153 Length = 1486 Score = 29.5 bits (63), Expect = 3.3 Identities = 16/46 (34%), Positives = 19/46 (41%) Frame = -3 Query: 401 PSHRSRWKLHTRPSRPNGKPSTSPKARHYGSS*SINGAFRHHKHRS 264 P H + + RP RPNG P A GS I +HRS Sbjct: 59 PRHSAAFSRSLRPCRPNGPPPAFASAEFPGSVPDIAQMPPRRRHRS 104 >06_01_0196 + 1520015-1520191,1520483-1520527,1521851-1521910, 1522246-1522358,1522432-1522642,1523087-1523133, 1523211-1523369,1523521-1523624,1524300-1524634 Length = 416 Score = 29.1 bits (62), Expect = 4.3 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +1 Query: 241 SDGFDEDGDRCLWCLKAP 294 SDGFDE D C CL+ P Sbjct: 282 SDGFDEGADACAVCLERP 299 >03_03_0042 + 14009649-14009866,14011342-14011419,14011791-14011955, 14012071-14012138,14012219-14012258,14013579-14013690, 14013859-14013942 Length = 254 Score = 29.1 bits (62), Expect = 4.3 Identities = 21/58 (36%), Positives = 30/58 (51%), Gaps = 1/58 (1%) Frame = -3 Query: 341 STSPKARHYGSS*SINGAFRHHK-HRSPSSSNPSLATKGSTSELTHRHSPLSFSPDLL 171 S SP++R++ S S + A R ++ HR S SL+ G HR + S SPD L Sbjct: 168 SRSPRSRYHSYSPSPSPARRDYRDHRDDYSPGESLSPHGQDKR-HHRSNGRSASPDEL 224 >11_01_0022 + 151233-151515,152632-152852,153579-153656,154558-154674, 155970-156316,156504-157032 Length = 524 Score = 28.7 bits (61), Expect = 5.7 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +2 Query: 551 NLKGFQVGAGCVSEHYACVR 610 N +QVG GC+S+ Y C+R Sbjct: 348 NATNYQVGTGCLSDIYFCLR 367 >10_05_0012 + 7874326-7874831,7929715-7931393,7931508-7933396 Length = 1357 Score = 28.7 bits (61), Expect = 5.7 Identities = 18/57 (31%), Positives = 23/57 (40%) Frame = -3 Query: 341 STSPKARHYGSS*SINGAFRHHKHRSPSSSNPSLATKGSTSELTHRHSPLSFSPDLL 171 ST P + +IN + H PSSS T T + H H P SF P + Sbjct: 973 STDPASSMVAFHININNLLQSFPHNKPSSSTKRHDTIPQTPYILHNH-PNSFLPQYI 1028 >03_06_0233 + 32530174-32530492,32531081-32531127,32531277-32531413, 32531673-32531841,32532598-32532885,32533021-32533107, 32533454-32534152,32534244-32534735 Length = 745 Score = 28.7 bits (61), Expect = 5.7 Identities = 15/52 (28%), Positives = 28/52 (53%) Frame = -3 Query: 374 HTRPSRPNGKPSTSPKARHYGSS*SINGAFRHHKHRSPSSSNPSLATKGSTS 219 H+ NG PS+ K R GSS ++ +F+ ++ S N +L++ +T+ Sbjct: 519 HSLDPELNGSPSSKDKLRKDGSSKLLSHSFKDLGNKDIRSDNVALSSVAATT 570 >02_02_0537 + 11308195-11309667 Length = 490 Score = 28.7 bits (61), Expect = 5.7 Identities = 18/57 (31%), Positives = 23/57 (40%) Frame = -3 Query: 341 STSPKARHYGSS*SINGAFRHHKHRSPSSSNPSLATKGSTSELTHRHSPLSFSPDLL 171 ST P + +IN + H PSSS T T + H H P SF P + Sbjct: 131 STDPASSMVAFHININNLLQSFPHNKPSSSTKRHDTIPQTPYILHNH-PNSFLPQYI 186 >01_05_0645 - 23899579-23904483 Length = 1634 Score = 28.7 bits (61), Expect = 5.7 Identities = 18/57 (31%), Positives = 23/57 (40%) Frame = -3 Query: 341 STSPKARHYGSS*SINGAFRHHKHRSPSSSNPSLATKGSTSELTHRHSPLSFSPDLL 171 ST P + +IN + H PSSS T T + H H P SF P + Sbjct: 1250 STDPASSMVAFHININNLLQSFPHNKPSSSTKRHDTIPQTPYILHNH-PNSFLPQYI 1305 >10_08_0898 + 21424379-21424792,21424974-21425723 Length = 387 Score = 28.3 bits (60), Expect = 7.6 Identities = 15/35 (42%), Positives = 18/35 (51%) Frame = -3 Query: 281 HHKHRSPSSSNPSLATKGSTSELTHRHSPLSFSPD 177 HH H PS AT +TS H+ S LSF+ D Sbjct: 101 HHHHHIGGMGEPSGATPSATSS-DHQTSMLSFADD 134 >04_04_1093 + 30825722-30826168,30826457-30826608,30826926-30827048, 30827240-30827384,30828032-30828093,30828373-30828586, 30829671-30830585,30830827-30831076,30831164-30831432 Length = 858 Score = 28.3 bits (60), Expect = 7.6 Identities = 22/67 (32%), Positives = 28/67 (41%), Gaps = 3/67 (4%) Frame = -3 Query: 371 TRPSRPNGKPSTSPKARHYGSS*SINGAFRHHKHRSPSSS---NPSLATKGSTSELTHRH 201 T P P+ PS+ P RH S + G R + SPS S PS + S S T Sbjct: 5 TAPPPPSSPPSSPPPLRH---SPAALGTPRSRRRHSPSPSLALTPSSSASASASASTSSR 61 Query: 200 SPLSFSP 180 + SP Sbjct: 62 PKVRPSP 68 >01_01_0060 + 477667-477816,479312-479722 Length = 186 Score = 28.3 bits (60), Expect = 7.6 Identities = 14/38 (36%), Positives = 21/38 (55%), Gaps = 1/38 (2%) Frame = -3 Query: 284 RHHKHRS-PSSSNPSLATKGSTSELTHRHSPLSFSPDL 174 RHH H S SSS+P +TK + ++L H ++ L Sbjct: 32 RHHHHYSTSSSSSPPSSTKEAVTQLDHLEQAAAYIKQL 69 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,572,888 Number of Sequences: 37544 Number of extensions: 470928 Number of successful extensions: 1235 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 1188 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1231 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2185924824 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -