BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_T7_F14 (800 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_56834| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.20 SB_8335| Best HMM Match : Dehydrin (HMM E-Value=7.2) 33 0.20 SB_18949| Best HMM Match : GTP_EFTU (HMM E-Value=1.7e-10) 30 0.28 SB_17758| Best HMM Match : Transformer (HMM E-Value=0.35) 33 0.36 SB_8398| Best HMM Match : Neuromodulin (HMM E-Value=8.4) 32 0.62 SB_6714| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.62 SB_31376| Best HMM Match : CLN3 (HMM E-Value=5.5e-06) 31 1.1 SB_35933| Best HMM Match : CIMR (HMM E-Value=6.3e-14) 30 2.5 SB_14000| Best HMM Match : DUF1213 (HMM E-Value=0.71) 29 3.3 SB_51335| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_5549| Best HMM Match : PT (HMM E-Value=1.9) 29 3.3 SB_51373| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_29377| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_1181| Best HMM Match : DUF1604 (HMM E-Value=0) 29 4.4 SB_8828| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.8 SB_20305| Best HMM Match : PT (HMM E-Value=1.8) 29 5.8 SB_11602| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.8 SB_13976| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.7 SB_13922| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.7 SB_43973| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.7 SB_36176| Best HMM Match : SEA (HMM E-Value=0.21) 28 7.7 SB_35319| Best HMM Match : Hexapep (HMM E-Value=0.35) 28 7.7 SB_33200| Best HMM Match : Spc97_Spc98 (HMM E-Value=0.0037) 28 7.7 SB_28981| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.7 >SB_56834| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 552 Score = 33.5 bits (73), Expect = 0.20 Identities = 21/85 (24%), Positives = 34/85 (40%) Frame = -2 Query: 361 VGQTKNNDRDFADAPKNLERNNSPPRGIFANIDFHEINSWKRPDKDVHEQKPKDADGQTE 182 V + N+D D + + E N G E N D D E++ +D+D E Sbjct: 380 VSEETNDDEDEDEEEEEEEENEDEENGEDEENGEDEENEENGEDDDDEEEEEEDSDESEE 439 Query: 181 VDKVENVPAPDETYGPKIPDNFKPN 107 + +E P+ T PK+ P+ Sbjct: 440 SEYLEEQPSRRSTVRPKVRPTALPS 464 >SB_8335| Best HMM Match : Dehydrin (HMM E-Value=7.2) Length = 531 Score = 33.5 bits (73), Expect = 0.20 Identities = 24/99 (24%), Positives = 45/99 (45%) Frame = -2 Query: 379 DSEDEDVGQTKNNDRDFADAPKNLERNNSPPRGIFANIDFHEINSWKRPDKDVHEQKPKD 200 D D++ + ++N R+ N ER++ R I + I+ + PDKD Q+P++ Sbjct: 321 DPRDKERRERRDNSRENQVRRDNDERDHPQDR-IRGRREEKPIDPNRGPDKDREPQRPRE 379 Query: 199 ADGQTEVDKVENVPAPDETYGPKIPDNFKPNLASQTCKQ 83 + + D+ PA D+ K D + + T +Q Sbjct: 380 SRPRERADRCAGPPAHDKRVRSKELDQSEERAENGTERQ 418 >SB_18949| Best HMM Match : GTP_EFTU (HMM E-Value=1.7e-10) Length = 783 Score = 29.9 bits (64), Expect(2) = 0.28 Identities = 19/58 (32%), Positives = 27/58 (46%), Gaps = 2/58 (3%) Frame = -2 Query: 271 NIDFH-EINSWKRPDKDVHEQKPKDADGQTEVDKVENVPAPDETYGP-KIPDNFKPNL 104 N DF +S K KD ++K K+ + DK+ N P E P K+P + NL Sbjct: 138 NDDFALSASSGKNKKKDKKDKKQKNKIDDDKEDKLTNTSTPSENVSPDKLPSDHGNNL 195 Score = 21.8 bits (44), Expect(2) = 0.28 Identities = 9/39 (23%), Positives = 20/39 (51%) Frame = -2 Query: 478 LKESEQNKNEGVQVTETINKFDKIDLYKSIFLSDSEDED 362 LKE +++K T ++F +D+ + ++ +D D Sbjct: 101 LKEPDESKTTQSAAPPTASRFQALDIEEPAEEANDDDND 139 >SB_17758| Best HMM Match : Transformer (HMM E-Value=0.35) Length = 974 Score = 32.7 bits (71), Expect = 0.36 Identities = 23/87 (26%), Positives = 33/87 (37%), Gaps = 1/87 (1%) Frame = -2 Query: 370 DEDVGQTKNNDRDFADAPKNLERNNSPPRGIFANI-DFHEINSWKRPDKDVHEQKPKDAD 194 D D T + DF AP + N +P F D + N+ PD V P D + Sbjct: 815 DPDDTVTAPDPEDFNTAPAPEDFNTAPDLDDFDTAPDLDDFNTAYDPDDIVMASDPDDIN 874 Query: 193 GQTEVDKVENVPAPDETYGPKIPDNFK 113 + D + PD+ PD+ K Sbjct: 875 TARDPDDIVTASDPDDVNTASDPDDIK 901 Score = 28.7 bits (61), Expect = 5.8 Identities = 21/75 (28%), Positives = 33/75 (44%), Gaps = 1/75 (1%) Frame = -2 Query: 367 EDVGQTKNNDRDFADAPKNLERNNS-PPRGIFANIDFHEINSWKRPDKDVHEQKPKDADG 191 ED + D DF AP + N + P I D +IN+ + PD V P D + Sbjct: 835 EDFNTAPDLD-DFDTAPDLDDFNTAYDPDDIVMASDPDDINTARDPDDIVTASDPDDVNT 893 Query: 190 QTEVDKVENVPAPDE 146 ++ D ++ PD+ Sbjct: 894 ASDPDDIKTASDPDD 908 >SB_8398| Best HMM Match : Neuromodulin (HMM E-Value=8.4) Length = 234 Score = 31.9 bits (69), Expect = 0.62 Identities = 24/101 (23%), Positives = 48/101 (47%), Gaps = 3/101 (2%) Frame = -2 Query: 475 KESEQNKNEGVQVTETINKFDKID---LYKSIFLSDSEDEDVGQTKNNDRDFADAPKNLE 305 K+ E ++N+ QV N+ D++D + KS+ ++ +E + G + + + P++L Sbjct: 19 KDMELSENDDKQVKPDQNRTDQMDSSHVEKSVEINKNETKASGFCNESVENTGNDPESLH 78 Query: 304 RNNSPPRGIFANIDFHEINSWKRPDKDVHEQKPKDADGQTE 182 + N+ + + HE R DKD + K +TE Sbjct: 79 KINTDKTNPDKSENTHENQRQNRNDKDPYYVKTGAIAMETE 119 >SB_6714| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 233 Score = 31.9 bits (69), Expect = 0.62 Identities = 27/146 (18%), Positives = 63/146 (43%), Gaps = 2/146 (1%) Frame = -2 Query: 475 KESEQNKNE-GVQVTETINKFDKIDLYKSIFLSDSEDEDVGQTKNNDRDFADAPKNLERN 299 KE++++K + + E ++K DK + + + E++ Q + + D + K + Sbjct: 20 KENKEDKEKMDKEDKEEMDKQDKENKEDKEEMDKEDKEEMDQEEMDKEDKEEMDKEDKEE 79 Query: 298 NSPPRGIFANIDFHEINSWKRPDKDVHEQKPKDADGQTEVDKVENVPAPDETYGP-KIPD 122 +D E++ + DK+ +Q+ D + + E+DK E E G ++ Sbjct: 80 MDQEEMDKEEMDQEEMDKEDKEDKEEMDQEEMDKEDKEEMDKEEMDKEDKEEMGKGEMDK 139 Query: 121 NFKPNLASQTCKQDVTLEIDSSSSSD 44 K + + K+++ E+D + Sbjct: 140 EDKEEMDQEMDKEEMDQEMDKEMDKE 165 >SB_31376| Best HMM Match : CLN3 (HMM E-Value=5.5e-06) Length = 416 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/46 (30%), Positives = 26/46 (56%), Gaps = 1/46 (2%) Frame = +2 Query: 305 LQILWRVREIAII-IFSLTDVFVFAVTEKYRFVQIDFIEFIYCLRH 439 LQ +++R + I+ + + +F+F +T YRF+ I F+ C H Sbjct: 283 LQEFFKIRRMWILAVLDVVPIFLFLLTSWYRFITDYRIIFVICFAH 328 >SB_35933| Best HMM Match : CIMR (HMM E-Value=6.3e-14) Length = 644 Score = 29.9 bits (64), Expect = 2.5 Identities = 13/41 (31%), Positives = 22/41 (53%) Frame = +1 Query: 187 FDRPHLWAFVREHLYRVSSKSLFRGNRY*RKYHGAVNCSSP 309 +D+ L+ EH+Y +S+ L++G Y KY V +P Sbjct: 383 YDKCSLYDNSTEHMYNISTLKLYKGESYIEKYGANVVWRTP 423 >SB_14000| Best HMM Match : DUF1213 (HMM E-Value=0.71) Length = 1281 Score = 29.5 bits (63), Expect = 3.3 Identities = 14/64 (21%), Positives = 30/64 (46%) Frame = -2 Query: 355 QTKNNDRDFADAPKNLERNNSPPRGIFANIDFHEINSWKRPDKDVHEQKPKDADGQTEVD 176 +TK D+D DA + + + + + K+PD+D + +P+ A +T+ Sbjct: 613 RTKPQDQDKQDASRKTKTRKPQDQAARPRQASRKTKTSKQPDQDKQDARPRQASRKTKTS 672 Query: 175 KVEN 164 K ++ Sbjct: 673 KPQD 676 >SB_51335| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 576 Score = 29.5 bits (63), Expect = 3.3 Identities = 46/191 (24%), Positives = 79/191 (41%), Gaps = 2/191 (1%) Frame = -2 Query: 622 KEQVSFSGSKSL-NREPVKIDTRPVSVTSTSNKTELVGAPKRMTVAELFLKESEQNKNEG 446 KE++ FSG K + + E D R VTS + E G KR + + E N + Sbjct: 387 KEKL-FSGLKGIVDSEESDEDDRGTKVTS---RREGGGEAKRKPKKRICVSSDEDNVSPK 442 Query: 445 VQVTETINKFDKIDLYKSIFLSDSEDEDVGQTKNNDRDFADAPKNLERNNSPPRGIFA-N 269 +V +T NK D++ + K DSED++ + N+D + D N + + + N Sbjct: 443 -KVKKT-NKKDEVIMKK-----DSEDDERSEEANDDNNNDDGDDNYDVDGDDKNEMEEDN 495 Query: 268 IDFHEINSWKRPDKDVHEQKPKDADGQTEVDKVENVPAPDETYGPKIPDNFKPNLASQTC 89 +++ S + + +V K K A + + + DE P K + C Sbjct: 496 GGANDVKSEEDSEIEV-PIKTKPAKSKKAFKLKSDDSSEDEESSDDGPRGSKSKKHKKRC 554 Query: 88 KQDVTLEIDSS 56 D E++ S Sbjct: 555 VSDSDSELEDS 565 >SB_5549| Best HMM Match : PT (HMM E-Value=1.9) Length = 282 Score = 29.5 bits (63), Expect = 3.3 Identities = 22/90 (24%), Positives = 40/90 (44%) Frame = -2 Query: 379 DSEDEDVGQTKNNDRDFADAPKNLERNNSPPRGIFANIDFHEINSWKRPDKDVHEQKPKD 200 +++ E + K+ D+ D P+++ + R + D E K+P+ D E KP+D Sbjct: 169 ENKPEKKPKAKSEDKP-EDMPEDMPEDKPEYRPEYKPEDKPEKKPEKKPE-DKSEDKPED 226 Query: 199 ADGQTEVDKVENVPAPDETYGPKIPDNFKP 110 DK+E+ P + P+ KP Sbjct: 227 KHKDKPEDKLEDKPEDKKEEKPEDNPEEKP 256 >SB_51373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 29.1 bits (62), Expect = 4.4 Identities = 16/70 (22%), Positives = 32/70 (45%), Gaps = 1/70 (1%) Frame = -2 Query: 505 KRMTVAELFLKESEQNKNEGVQVTETINKFDKIDLYKSIFLSD-SEDEDVGQTKNNDRDF 329 KR+ E + + E+ + ++ FDK D+++ +S+ + +E T + D Sbjct: 74 KRLKDPEKYKNQDERRGGSKSRSHHRLHAFDKYDVHRDTGVSEFASNESRSSTNEDTGDV 133 Query: 328 ADAPKNLERN 299 D K E+N Sbjct: 134 IDVVKEAEKN 143 >SB_29377| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 548 Score = 29.1 bits (62), Expect = 4.4 Identities = 20/69 (28%), Positives = 33/69 (47%) Frame = -2 Query: 379 DSEDEDVGQTKNNDRDFADAPKNLERNNSPPRGIFANIDFHEINSWKRPDKDVHEQKPKD 200 D +D D G+ K+ DRD + K+ +R+ R D + K D+D ++ KD Sbjct: 334 DKKDRDRGRNKDRDRD-KERDKDRDRDKERDREKDRERD---KDRDKERDRDKDREREKD 389 Query: 199 ADGQTEVDK 173 D + + DK Sbjct: 390 RDKERDRDK 398 >SB_1181| Best HMM Match : DUF1604 (HMM E-Value=0) Length = 1035 Score = 29.1 bits (62), Expect = 4.4 Identities = 13/39 (33%), Positives = 22/39 (56%) Frame = -2 Query: 160 PAPDETYGPKIPDNFKPNLASQTCKQDVTLEIDSSSSSD 44 P+ E YGP +P + P ++S+ C +T+ S+ SD Sbjct: 812 PSDTEAYGPALPQSSVP-VSSKQCVNTITISKVSAERSD 849 >SB_8828| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 28.7 bits (61), Expect = 5.8 Identities = 13/45 (28%), Positives = 21/45 (46%) Frame = -2 Query: 364 DVGQTKNNDRDFADAPKNLERNNSPPRGIFANIDFHEINSWKRPD 230 D+ +ND ADA L ++ +P G F D +++ R D Sbjct: 16 DIQYRSSNDHSTADALSRLPQHRAPKDGYFDLADLYQVGGSSRVD 60 >SB_20305| Best HMM Match : PT (HMM E-Value=1.8) Length = 127 Score = 28.7 bits (61), Expect = 5.8 Identities = 24/99 (24%), Positives = 40/99 (40%), Gaps = 1/99 (1%) Frame = -2 Query: 373 EDEDVGQTKNNDRDFA-DAPKNLERNNSPPRGIFANIDFHEINSWKRPDKDVHEQKPKDA 197 ED+ G+ K+ D + D P++ N + D E + +P+ D E KP+D Sbjct: 14 EDKPEGKPKDKSEDKSGDKPQDKPENKPEDQPEDKPGDKPEDKTEDKPE-DKPEDKPEDK 72 Query: 196 DGQTEVDKVENVPAPDETYGPKIPDNFKPNLASQTCKQD 80 DK+E+ P P+ KP + +D Sbjct: 73 PEDKPEDKLEDKPEDSSEEKPEDNPEDKPEYKPEDKPED 111 >SB_11602| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 440 Score = 28.7 bits (61), Expect = 5.8 Identities = 14/45 (31%), Positives = 20/45 (44%) Frame = -3 Query: 240 RDPIKMFTNKSPKMRTVKRKSIKSRMFRLPTKLTDLKYRIILNRT 106 RDP+ + P R + +R R P K TD +Y + N T Sbjct: 160 RDPVNNSDTRDPVNNRDTRDPVNNRDTRYPVKYTDTRYPVNNNDT 204 >SB_13976| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 763 Score = 28.3 bits (60), Expect = 7.7 Identities = 14/42 (33%), Positives = 20/42 (47%) Frame = -2 Query: 274 ANIDFHEINSWKRPDKDVHEQKPKDADGQTEVDKVENVPAPD 149 AN +NS +PDK VH K + G + E +P P+ Sbjct: 460 ANNSSKPLNSATKPDKKVHRPK-EHCTGPEMIPGAETIPGPE 500 >SB_13922| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1012 Score = 28.3 bits (60), Expect = 7.7 Identities = 14/50 (28%), Positives = 23/50 (46%) Frame = -1 Query: 743 TFPXPGGANTEGKHSRATRRFXTPSFRNMESSVHXQRQLRERTSLVQWIK 594 +F G + GKH + + T + ++ Q QL +R SL W+K Sbjct: 708 SFTTSGQSLLSGKHHKCGNKNCTSDILSAPLYLYIQMQLCQRESLKDWLK 757 >SB_43973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3142 Score = 28.3 bits (60), Expect = 7.7 Identities = 17/53 (32%), Positives = 26/53 (49%), Gaps = 4/53 (7%) Frame = -2 Query: 202 DADGQTEVDKVENVPAPDETYG----PKIPDNFKPNLASQTCKQDVTLEIDSS 56 D DG D+ ++ TYG P IP+N L QT +D+ E+++S Sbjct: 2020 DIDGGI-TDQTDSKEGSQPTYGRQYWPTIPNNMPTTLHDQTTPRDLLTELNAS 2071 >SB_36176| Best HMM Match : SEA (HMM E-Value=0.21) Length = 242 Score = 28.3 bits (60), Expect = 7.7 Identities = 19/62 (30%), Positives = 24/62 (38%), Gaps = 1/62 (1%) Frame = -2 Query: 304 RNNSPPRGIFANIDFHEINSWKRPDKDVHEQKPK-DADGQTEVDKVENVPAPDETYGPKI 128 R P+ F + F S+ D E P T D ++V APD TYG Sbjct: 143 REAGAPQKQFQHQTFDNPISFSSRAYDADEPNPAVTIPDMTPPDVTQSVTAPDATYGVAF 202 Query: 127 PD 122 PD Sbjct: 203 PD 204 >SB_35319| Best HMM Match : Hexapep (HMM E-Value=0.35) Length = 254 Score = 28.3 bits (60), Expect = 7.7 Identities = 14/43 (32%), Positives = 21/43 (48%) Frame = -2 Query: 451 EGVQVTETINKFDKIDLYKSIFLSDSEDEDVGQTKNNDRDFAD 323 +GV V E + + +D+ + L D D G T +D DF D Sbjct: 7 DGVDVVEDVGLLEDVDVVDGVTLLDDIDVVDGVTLLDDVDFVD 49 >SB_33200| Best HMM Match : Spc97_Spc98 (HMM E-Value=0.0037) Length = 1235 Score = 28.3 bits (60), Expect = 7.7 Identities = 15/39 (38%), Positives = 19/39 (48%) Frame = -1 Query: 788 SXIHGGPKRSWARDLTFPXPGGANTEGKHSRATRRFXTP 672 S HG P S ++ +P PG NT + ATR TP Sbjct: 470 SEAHGHPLDSTVSNVMYPTPGAGNTP-TATEATRNNATP 507 >SB_28981| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 655 Score = 28.3 bits (60), Expect = 7.7 Identities = 17/67 (25%), Positives = 34/67 (50%), Gaps = 1/67 (1%) Frame = -2 Query: 508 PKRMTVAELFLKESEQNKNEGVQVTETINKFDKI-DLYKSIFLSDSEDEDVGQTKNNDRD 332 PK+ E ++ E N G+ E + + + + D +S ++ +E++DV + K+ + Sbjct: 417 PKKKPNGESVTEDGEVNIEAGIANEEQVEQEEALNDSQRSGEINQAEEDDVDKDKDVEEK 476 Query: 331 FADAPKN 311 ADA N Sbjct: 477 AADAIVN 483 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,535,887 Number of Sequences: 59808 Number of extensions: 463563 Number of successful extensions: 2045 Number of sequences better than 10.0: 24 Number of HSP's better than 10.0 without gapping: 1758 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2022 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2215746665 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -