BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_T7_F14 (800 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF213012-1|AAG43568.1| 492|Apis mellifera acetylcholinesterase ... 25 0.62 AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase ... 25 0.62 DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related pro... 24 1.9 AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 23 2.5 DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex det... 22 5.8 DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex det... 22 5.8 DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex det... 22 5.8 DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex det... 22 5.8 DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex det... 22 5.8 DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex det... 22 5.8 DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex det... 22 5.8 AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 22 5.8 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 22 5.8 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 22 5.8 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 22 5.8 AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 22 5.8 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 22 5.8 AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. 22 5.8 AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 22 5.8 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 22 5.8 AJ780964-1|CAG62942.2| 332|Apis mellifera putative corticotropi... 22 5.8 AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 22 5.8 >AF213012-1|AAG43568.1| 492|Apis mellifera acetylcholinesterase protein. Length = 492 Score = 25.4 bits (53), Expect = 0.62 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +1 Query: 409 FYRIYLLSPSLGPLRFCSAPIPLK 480 FY I P +GPLRF P+P++ Sbjct: 62 FYGIPFAKPPIGPLRF-RKPLPIE 84 >AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase protein. Length = 628 Score = 25.4 bits (53), Expect = 0.62 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +1 Query: 409 FYRIYLLSPSLGPLRFCSAPIPLK 480 FY I P +GPLRF P+P++ Sbjct: 62 FYGIPFAKPPIGPLRF-RKPLPIE 84 >DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related protein STG-1 protein. Length = 397 Score = 23.8 bits (49), Expect = 1.9 Identities = 15/55 (27%), Positives = 24/55 (43%), Gaps = 3/55 (5%) Frame = -2 Query: 271 NIDFHEINSWKRPDKDVHE---QKPKDADGQTEVDKVENVPAPDETYGPKIPDNF 116 ++DF E P+ D H+ Q P+D QT + + +E Y P + F Sbjct: 313 HVDFDEFLP-PPPNLDYHDYSRQFPRDLTTQTVSTTADVLQEEEEEYSPSVQHEF 366 >AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform A protein. Length = 782 Score = 23.4 bits (48), Expect = 2.5 Identities = 14/47 (29%), Positives = 25/47 (53%) Frame = -2 Query: 475 KESEQNKNEGVQVTETINKFDKIDLYKSIFLSDSEDEDVGQTKNNDR 335 + +E++ + V+ ET ++FD I + LS S D G ++DR Sbjct: 161 QNAEEDIVDPVEENETYDEFDTIRIPIVRSLSKSPPNDEGIETDSDR 207 >DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 22.2 bits (45), Expect = 5.8 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = +1 Query: 706 FPSVFAPPGXGNVKSLAHXRFGP 774 FP F PP ++ + RFGP Sbjct: 128 FPPRFIPPDMYRLRPPPNPRFGP 150 >DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 22.2 bits (45), Expect = 5.8 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = +1 Query: 706 FPSVFAPPGXGNVKSLAHXRFGP 774 FP F PP ++ + RFGP Sbjct: 128 FPPRFIPPDMYRLRPPPNPRFGP 150 >DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 22.2 bits (45), Expect = 5.8 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = +1 Query: 706 FPSVFAPPGXGNVKSLAHXRFGP 774 FP F PP ++ + RFGP Sbjct: 128 FPPRFIPPDMYRLRPPPNPRFGP 150 >DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 22.2 bits (45), Expect = 5.8 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = +1 Query: 706 FPSVFAPPGXGNVKSLAHXRFGP 774 FP F PP ++ + RFGP Sbjct: 128 FPPRFIPPDMYRLRPPPNPRFGP 150 >DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 22.2 bits (45), Expect = 5.8 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = +1 Query: 706 FPSVFAPPGXGNVKSLAHXRFGP 774 FP F PP ++ + RFGP Sbjct: 128 FPPRFIPPDMYRLRPPPNPRFGP 150 >DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 22.2 bits (45), Expect = 5.8 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = +1 Query: 706 FPSVFAPPGXGNVKSLAHXRFGP 774 FP F PP ++ + RFGP Sbjct: 128 FPPRFIPPDMYRLRPPPNPRFGP 150 >DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 22.2 bits (45), Expect = 5.8 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = +1 Query: 706 FPSVFAPPGXGNVKSLAHXRFGP 774 FP F PP ++ + RFGP Sbjct: 128 FPPRFIPPDMYRLRPPPNPRFGP 150 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 5.8 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = +1 Query: 706 FPSVFAPPGXGNVKSLAHXRFGP 774 FP F PP ++ + RFGP Sbjct: 377 FPPRFIPPDMYRLRPPPNPRFGP 399 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 5.8 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = +1 Query: 706 FPSVFAPPGXGNVKSLAHXRFGP 774 FP F PP ++ + RFGP Sbjct: 377 FPPRFIPPDMYRLRPPPNPRFGP 399 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 5.8 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = +1 Query: 706 FPSVFAPPGXGNVKSLAHXRFGP 774 FP F PP ++ + RFGP Sbjct: 377 FPPRFIPPDMYRLRPPPNPRFGP 399 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 5.8 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = +1 Query: 706 FPSVFAPPGXGNVKSLAHXRFGP 774 FP F PP ++ + RFGP Sbjct: 377 FPPRFIPPDMYRLRPPPNPRFGP 399 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 5.8 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = +1 Query: 706 FPSVFAPPGXGNVKSLAHXRFGP 774 FP F PP ++ + RFGP Sbjct: 377 FPPRFIPPDMYRLRPPPNPRFGP 399 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 5.8 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = +1 Query: 706 FPSVFAPPGXGNVKSLAHXRFGP 774 FP F PP ++ + RFGP Sbjct: 377 FPPRFIPPDMYRLRPPPNPRFGP 399 >AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. Length = 400 Score = 22.2 bits (45), Expect = 5.8 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = +1 Query: 706 FPSVFAPPGXGNVKSLAHXRFGP 774 FP F PP ++ + RFGP Sbjct: 376 FPPRFIPPDMYRLRPPPNPRFGP 398 >AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex determiner protein. Length = 385 Score = 22.2 bits (45), Expect = 5.8 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = +1 Query: 706 FPSVFAPPGXGNVKSLAHXRFGP 774 FP F PP ++ + RFGP Sbjct: 361 FPPRFIPPDMYRLRPPPNPRFGP 383 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 22.2 bits (45), Expect = 5.8 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = +1 Query: 706 FPSVFAPPGXGNVKSLAHXRFGP 774 FP F PP ++ + RFGP Sbjct: 377 FPPRFIPPDMYRLRPPPNPRFGP 399 >AJ780964-1|CAG62942.2| 332|Apis mellifera putative corticotropin releasing hormone-binding protein protein. Length = 332 Score = 22.2 bits (45), Expect = 5.8 Identities = 16/56 (28%), Positives = 23/56 (41%), Gaps = 6/56 (10%) Frame = +3 Query: 429 VSVTWTPS-FLFCSDSFKNNSATVILLGAPTSSV-----LFDVDVTETGLVSILTG 578 + VT P FL+ S + + L P + FD+ GLVSI+ G Sbjct: 71 IFVTSEPGYFLYTSKNDNEEVCGIYFLAEPDQKIEINFITFDIPCEHRGLVSIIDG 126 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 22.2 bits (45), Expect = 5.8 Identities = 7/25 (28%), Positives = 17/25 (68%) Frame = +3 Query: 480 NNSATVILLGAPTSSVLFDVDVTET 554 + +AT++L G P++ + VD+ ++ Sbjct: 847 STAATLVLSGCPSNMMELQVDIADS 871 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 210,512 Number of Sequences: 438 Number of extensions: 4795 Number of successful extensions: 28 Number of sequences better than 10.0: 22 Number of HSP's better than 10.0 without gapping: 28 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 28 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 25367793 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -