BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_T7_F13 (778 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY119125-1|AAM50985.1| 553|Drosophila melanogaster RE28286p pro... 32 1.0 AE014298-1861|AAF48238.3| 625|Drosophila melanogaster CG12723-P... 32 1.0 AE014296-3425|AAF51645.2| 926|Drosophila melanogaster CG3680-PA... 29 9.4 >AY119125-1|AAM50985.1| 553|Drosophila melanogaster RE28286p protein. Length = 553 Score = 31.9 bits (69), Expect = 1.0 Identities = 26/71 (36%), Positives = 35/71 (49%), Gaps = 4/71 (5%) Frame = -1 Query: 712 SSXPPLRXRXHQPDHQI----PRFHTPTTPDLTSISINPLTPY*KEFAPGLKPPLSSEAP 545 S PP R QP + P P +P+ SI++ P PY A G PP+ S+ P Sbjct: 439 SEVPPQRPSVQQPWKPVFYSPPTESAPASPNRPSITLLP--PYGSAPAEGYLPPVGSQ-P 495 Query: 544 SAYLTPSSLGM 512 SA L+ SS G+ Sbjct: 496 SA-LSASSAGI 505 >AE014298-1861|AAF48238.3| 625|Drosophila melanogaster CG12723-PA protein. Length = 625 Score = 31.9 bits (69), Expect = 1.0 Identities = 26/71 (36%), Positives = 35/71 (49%), Gaps = 4/71 (5%) Frame = -1 Query: 712 SSXPPLRXRXHQPDHQI----PRFHTPTTPDLTSISINPLTPY*KEFAPGLKPPLSSEAP 545 S PP R QP + P P +P+ SI++ P PY A G PP+ S+ P Sbjct: 511 SEVPPQRPSVQQPWKPVFYSPPTESAPASPNRPSITLLP--PYGSAPAEGYLPPVGSQ-P 567 Query: 544 SAYLTPSSLGM 512 SA L+ SS G+ Sbjct: 568 SA-LSASSAGI 577 >AE014296-3425|AAF51645.2| 926|Drosophila melanogaster CG3680-PA protein. Length = 926 Score = 28.7 bits (61), Expect = 9.4 Identities = 19/51 (37%), Positives = 24/51 (47%) Frame = -1 Query: 646 PTTPDLTSISINPLTPY*KEFAPGLKPPLSSEAPSAYLTPSSLGMXKGVSP 494 PTTP T SI+P T KE AP + + + TP G +G SP Sbjct: 413 PTTPKTTVKSISPTTTTKKEVAPKKRSATPTARSTKAGTPVG-GTERGPSP 462 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 32,247,247 Number of Sequences: 53049 Number of extensions: 675015 Number of successful extensions: 1828 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1733 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1826 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3602427675 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -