BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_T7_F06 (808 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_51931| Best HMM Match : Ribosomal_L3 (HMM E-Value=0) 150 1e-36 SB_14332| Best HMM Match : Ribosomal_L3 (HMM E-Value=8.6e-34) 140 2e-33 SB_7140| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 1e-20 SB_52432| Best HMM Match : NDUF_B7 (HMM E-Value=0.47) 29 3.4 SB_51282| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_4606| Best HMM Match : HlyIII (HMM E-Value=0.002) 29 3.4 SB_13763| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_35285| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.9 SB_6540| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.9 SB_26123| Best HMM Match : NHL (HMM E-Value=3.5e-08) 28 7.7 >SB_51931| Best HMM Match : Ribosomal_L3 (HMM E-Value=0) Length = 338 Score = 150 bits (363), Expect = 1e-36 Identities = 83/155 (53%), Positives = 100/155 (64%), Gaps = 2/155 (1%) Frame = -2 Query: 807 HTQMKLLXXDKXRXHIMESNLXGYHRGQSEMG--QRTSGETYPCRFCVCPR*ND*LHWCH 634 HTQ KLL + + HIME + G ++ + P R P + Sbjct: 164 HTQQKLLKMRQKKAHIMEIQVNGGKDVAEKVDWCRERLENPAPVRKVFSPDEMIDVIGVT 223 Query: 633 PRXKDTKVSLLVGTQRSYPVRHTKGLRKVACIGAWHPSRVSFTVARAGQKGYHHRTEMNK 454 V+ GT++ P + KGLRKVACIGAWHP+RVSF+VARAGQ GYHHRTE+NK Sbjct: 224 KGHGFKGVTYRWGTKK-LPRKTHKGLRKVACIGAWHPARVSFSVARAGQAGYHHRTELNK 282 Query: 453 KIYRIGQGIHKKDGKVIKNNASTEYDLSEKSITPM 349 KIYRIGQGIHKKDGKVIKNNASTEYDL++KSI+PM Sbjct: 283 KIYRIGQGIHKKDGKVIKNNASTEYDLTDKSISPM 317 Score = 51.6 bits (118), Expect = 7e-07 Identities = 22/36 (61%), Positives = 26/36 (72%) Frame = -3 Query: 734 IEDKVKWAREHLEKPIPVDSVFAQDEMIDCIGVTQG 627 + +KV W RE LE P PV VF+ DEMID IGVT+G Sbjct: 190 VAEKVDWCRERLENPAPVRKVFSPDEMIDVIGVTKG 225 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/24 (75%), Positives = 20/24 (83%) Frame = -1 Query: 631 KXKGYKGVTSRWHTKKLPRKTHQG 560 K G+KGVT RW TKKLPRKTH+G Sbjct: 224 KGHGFKGVTYRWGTKKLPRKTHKG 247 >SB_14332| Best HMM Match : Ribosomal_L3 (HMM E-Value=8.6e-34) Length = 347 Score = 140 bits (338), Expect = 2e-33 Identities = 62/82 (75%), Positives = 70/82 (85%) Frame = -2 Query: 348 GGFPHYGEVNNDFVMIKGCCMGPKKRIITLRKSLRVHTKRAALEKINLKFIDTSSKFGHG 169 GGFPHYG+VN DF+M+KGC +GPKKR++TLRKSL VHT R A EKI LKFIDTSSKFGHG Sbjct: 215 GGFPHYGQVNEDFLMVKGCVVGPKKRVLTLRKSLLVHTSRDAAEKITLKFIDTSSKFGHG 274 Query: 168 RFQTPADKAAFMGTLKKDRIRE 103 RFQ PA+K AFMG LK DR +E Sbjct: 275 RFQHPAEKRAFMGMLKSDREKE 296 >SB_7140| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 97.1 bits (231), Expect = 1e-20 Identities = 42/45 (93%), Positives = 45/45 (100%) Frame = -2 Query: 483 GYHHRTEMNKKIYRIGQGIHKKDGKVIKNNASTEYDLSEKSITPM 349 GYHHRTE+NKKIYRIGQGIHKKDGKVIKNNASTEYDL++KSITPM Sbjct: 2 GYHHRTELNKKIYRIGQGIHKKDGKVIKNNASTEYDLTDKSITPM 46 >SB_52432| Best HMM Match : NDUF_B7 (HMM E-Value=0.47) Length = 1250 Score = 29.5 bits (63), Expect = 3.4 Identities = 12/34 (35%), Positives = 16/34 (47%) Frame = -3 Query: 728 DKVKWAREHLEKPIPVDSVFAQDEMIDCIGVTQG 627 D++ W H P P Q++ D IGVT G Sbjct: 213 DEILWLVRHCCNPAPRSRKLTQEDFFDSIGVTAG 246 >SB_51282| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 217 Score = 29.5 bits (63), Expect = 3.4 Identities = 14/42 (33%), Positives = 21/42 (50%) Frame = -2 Query: 423 KKDGKVIKNNASTEYDLSEKSITPMGGFPHYGEVNNDFVMIK 298 KK V +N+ T D + + GFPHY + +D + IK Sbjct: 44 KKCWTVTQNDVPTPLDCGLSAWRILSGFPHYKLIEDDHIEIK 85 >SB_4606| Best HMM Match : HlyIII (HMM E-Value=0.002) Length = 458 Score = 29.5 bits (63), Expect = 3.4 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +1 Query: 34 NVYFHGLHLRLRSSRWGCGSRSFFANTILLE 126 N+Y HG+ L LR +GCGS +L++ Sbjct: 368 NIYSHGVRLFLRYLGYGCGSDGALPYCVLMD 398 >SB_13763| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 319 Score = 29.5 bits (63), Expect = 3.4 Identities = 16/47 (34%), Positives = 23/47 (48%) Frame = +1 Query: 466 STVMITFLTSTSYSERHPRRMPSSNAGNFPKTLGVSYGVASLCANEK 606 S I+F +T Y +RH RR S N +F + G ++L N K Sbjct: 96 SRTPISFPNTTQYRDRHARRSRSQNGVSFLINIATLVGDSALGTNIK 142 >SB_35285| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 561 Score = 28.7 bits (61), Expect = 5.9 Identities = 14/54 (25%), Positives = 27/54 (50%) Frame = +1 Query: 331 IMGETSHRCNGFLRQIILSRCIVFNNFAILFVDSLSNTIDFLVHFSTVMITFLT 492 ++GE FLR++ +S C++ N+ F + D L+ F++ + F T Sbjct: 274 VLGENFQDLARFLRELQISPCLMVLNYPSFFSADIQKLNDALMFFTSRPLLFET 327 >SB_6540| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 366 Score = 28.7 bits (61), Expect = 5.9 Identities = 14/50 (28%), Positives = 24/50 (48%) Frame = -2 Query: 279 KKRIITLRKSLRVHTKRAALEKINLKFIDTSSKFGHGRFQTPADKAAFMG 130 K R++ +K ++H+ + K ++F+ SKF H T A A G Sbjct: 317 KDRLLEWKKERQIHSFSSTTLKARIRFVAAMSKFAHTTEDTTAWDEATKG 366 >SB_26123| Best HMM Match : NHL (HMM E-Value=3.5e-08) Length = 545 Score = 28.3 bits (60), Expect = 7.7 Identities = 14/42 (33%), Positives = 18/42 (42%) Frame = -1 Query: 166 IPDAG*QGCIHGYTQEGSYSRRSCGYHNPSGCCAALSVVREN 41 I D G CIH +T +G Y C + + G REN Sbjct: 410 ISDDG-ANCIHVFTLDGQYVSNECSWESHEGYTHIAVTAREN 450 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,752,252 Number of Sequences: 59808 Number of extensions: 576219 Number of successful extensions: 1314 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 1230 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1314 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2239700683 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -