BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_T7_E24 (888 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC25G10.09c ||SPAC27F1.01c|actin cortical patch component, wit... 28 2.0 SPBC146.07 |prp2|mis11|U2AF large subunit |Schizosaccharomyces p... 27 3.6 SPCC895.05 |for3||formin For3|Schizosaccharomyces pombe|chr 3|||... 27 3.6 SPBC13E7.09 |vrp1||verprolin|Schizosaccharomyces pombe|chr 2|||M... 27 4.7 SPBC428.02c |eca39|SPBC582.12c|branched chain amino acid aminotr... 26 8.2 >SPAC25G10.09c ||SPAC27F1.01c|actin cortical patch component, with EF hand and WH2 motif |Schizosaccharomyces pombe|chr 1|||Manual Length = 1794 Score = 27.9 bits (59), Expect = 2.0 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +2 Query: 686 PLPPPXXXLSXPXVPPXPXVLPXPPXPXXSXXXXRSRPXP 805 P PPP P PP P P P P S P P Sbjct: 1707 PPPPPMSVPPPPSAPPMPAGPPSAPPPPLPASSAPSVPNP 1746 Score = 26.6 bits (56), Expect = 4.7 Identities = 12/35 (34%), Positives = 14/35 (40%) Frame = +2 Query: 710 LSXPXVPPXPXVLPXPPXPXXSXXXXRSRPXPHXP 814 +S P PP P +P PP S P P P Sbjct: 1702 MSAPTPPPPPMSVPPPPSAPPMPAGPPSAPPPPLP 1736 >SPBC146.07 |prp2|mis11|U2AF large subunit |Schizosaccharomyces pombe|chr 2|||Manual Length = 517 Score = 27.1 bits (57), Expect = 3.6 Identities = 12/35 (34%), Positives = 19/35 (54%), Gaps = 4/35 (11%) Frame = -3 Query: 331 PPPP----LRSLISNLSNTCDLTPLPEWSCEQSAW 239 PPP +RS+ L D+TP+ +W ++S W Sbjct: 101 PPPSRERSVRSIEQELEQLRDVTPINQWKRKRSLW 135 >SPCC895.05 |for3||formin For3|Schizosaccharomyces pombe|chr 3|||Manual Length = 1461 Score = 27.1 bits (57), Expect = 3.6 Identities = 12/31 (38%), Positives = 15/31 (48%), Gaps = 4/31 (12%) Frame = +2 Query: 686 PLPPPXXXLSXPXVPPXPXVL----PXPPXP 766 P+PPP + P PP P + P PP P Sbjct: 750 PVPPPAPIMGGPPPPPPPPGVAGAGPPPPPP 780 >SPBC13E7.09 |vrp1||verprolin|Schizosaccharomyces pombe|chr 2|||Manual Length = 309 Score = 26.6 bits (56), Expect = 4.7 Identities = 15/44 (34%), Positives = 17/44 (38%), Gaps = 1/44 (2%) Frame = +2 Query: 686 PLPPPXXXLSXPX-VPPXPXVLPXPPXPXXSXXXXRSRPXPHXP 814 P+ P S P VPP P +P PP SRP P Sbjct: 180 PVKSPPSAPSLPSAVPPMPPKVPPPPLSQAPVANTSSRPSSFAP 223 >SPBC428.02c |eca39|SPBC582.12c|branched chain amino acid aminotransferase Eca39|Schizosaccharomyces pombe|chr 2|||Manual Length = 380 Score = 25.8 bits (54), Expect = 8.2 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -3 Query: 328 PPPLRSLISNLSNTCDLTPLPEW 260 P P+ S ++N +L PLPEW Sbjct: 10 PKPMDSSHIKVTNVKELKPLPEW 32 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,556,302 Number of Sequences: 5004 Number of extensions: 18009 Number of successful extensions: 62 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 41 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 58 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 446488370 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -